PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013619527.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 342aa    MW: 38512.6 Da    PI: 8.0866
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013619527.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.53.5e-152159241
             TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41
                    ++kgC+C++skClk+YC+Cfa+g+ C++ C C dC+N+ +
  XP_013619527.1 21 KQKGCRCRQSKCLKLYCDCFASGVLCND-CDCADCHNNAD 59
                    89**************************.********987 PP

2TCR491.2e-15103138439
             TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     +gC+Ck++kClkkYCeCf+a++ Cs +CkC +C+N 
  XP_013619527.1 103 RGCKCKRTKCLKKYCECFQANALCSGNCKCINCENV 138
                     79*********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.6E-162060IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163429.01721140IPR005172CRC domain
PfamPF036386.5E-122257IPR005172CRC domain
SMARTSM011144.2E-14100141IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.2E-12103137IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MTSRGEREGN NTDQEGVTGR KQKGCRCRQS KCLKLYCDCF ASGVLCNDCD CADCHNNADN  60
SYAREAAVLN LLDRNPNAFK GKPPSFSIDK QAATDTKLGL LSRGCKCKRT KCLKKYCECF  120
QANALCSGNC KCINCENVSA LGATNRHNVG FNTPDNLICA PQSSLQVYRR RRYRELLPEW  180
NSCPAPLSSM PDNYILDSLE YPMYSSPKLP YRKKRSRLGC NTPKLVPDLG DLRSLLLAAS  240
ESATANAGLQ DKNRICIKPD DKELWNESES GIVEEEDIQS CGRLIQLIDA QYNDEVNSQT  300
KTSSPERDVY MEQERAVLET FRDCLHKYMK VGFKKGTNYY HF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-20181387121Protein lin-54 homolog
5fd3_B1e-20181387121Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013619527.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013619527.10.0PREDICTED: protein tesmin/TSO1-like CXC 8
SwissprotQ700D01e-133TCX8_ARATH; Protein tesmin/TSO1-like CXC 8
TrEMBLA0A3P6FZ180.0A0A3P6FZ18_BRAOL; Uncharacterized protein (Fragment)
STRINGBo1g123680.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM148441520
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16160.11e-107Tesmin/TSO1-like CXC domain-containing protein