PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618975.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YA
Protein Properties Length: 303aa    MW: 33305.5 Da    PI: 10.6727
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618975.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA1032.7e-32180236158
       CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                     +ep++VNaKQyq+Il+RRq+Rakle+++kl +k+rkpylheSRh hAl+R+RgsgGrF
  XP_013618975.1 180 NEPIFVNAKQYQAILRRRQHRAKLEAQNKL-IKARKPYLHESRHLHALKRARGSGGRF 236
                     59****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005218.0E-37178239IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.866179239IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.1E-27181236IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.5E-22182204IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860184204IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.5E-22213236IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MQEFHRKDSL TSPTTSWGNS VFSNSNVQGS SSSAMTDNNT LSLTMEMMSA HFPGRKQTGF  60
QLQGHDDSSS TLSTGGGESS GDVASLGGHN SNNRYGHKFV THLSGHKEIA VSPSGSHPKS  120
ILSKVSQNSA APTIEASWPL HGNCFMSFPY ASQHMVQQHP QIGGLMIPSR ILLPPNIPEN  180
EPIFVNAKQY QAILRRRQHR AKLEAQNKLI KARKPYLHES RHLHALKRAR GSGGRFLNTK  240
KLQESKSPPF LATSVKFRQR EILGVAVGSS GPELTGNNMD MFQQDPQLRF SGYPSNHHVS  300
VLM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-19180248267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}.
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013618975.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618975.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
RefseqXP_013618981.10.0PREDICTED: nuclear transcription factor Y subunit A-6 isoform X1
SwissprotQ9LVJ71e-123NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLA0A0D3ADS60.0A0A0D3ADS6_BRAOL; Uncharacterized protein
STRINGBo1g134650.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM147331620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-107nuclear factor Y, subunit A6
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]