PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013617909.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 161aa    MW: 18567.5 Da    PI: 9.5348
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013617909.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF50.52.7e-161057249
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    +i n+  r+ tf kR++g+lKK +ELS+LC+++v+  i s +++  e+
  XP_013617909.1 10 PITNSAARNQTFRKRKKGLLKKTNELSTLCGVKVCAFINSCDNTETEF 57
                    799**********************************99999887666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006617.311161IPR002100Transcription factor, MADS-box
SMARTSM004324.6E-20160IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.75E-20395IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-10323IPR002100Transcription factor, MADS-box
PfamPF003193.7E-161153IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-102338IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-103859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 161 aa     Download sequence    Send to blast
MPKGRIKIEP ITNSAARNQT FRKRKKGLLK KTNELSTLCG VKVCAFINSC DNTETEFWPS  60
REGAEAGHSA FMGVLPEERC KKTYDQERHL EERIQKGQEK AMKLQAENRE IELREVIFDL  120
LKGKTLMPHQ YGDPSFMREL NLFIGGYANK VSLWTQFLKC P
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125RKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013617909.11e-118PREDICTED: MADS-box transcription factor PHERES 1-like
TrEMBLA0A0D3AXJ91e-118A0A0D3AXJ9_BRAOL; Uncharacterized protein
STRINGBra020552.1-P3e-89(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14795620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65330.16e-37M-type_MADS family protein