PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013617898.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 100aa    MW: 11494.3 Da    PI: 10.018
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013617898.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.21.9e-17952144
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    ++i n+s r+ tf kR++ +lKKA+ELS+LC+++v+ +i s ++
  XP_013617898.1  9 EPITNSSARNQTFRKRKKCLLKKANELSTLCGVKVCAVINSCDN 52
                    5799***********************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.54149IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-17161IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-8323IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-22391IPR002100Transcription factor, MADS-box
PfamPF003193.7E-181152IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-82338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 100 aa     Download sequence    Send to blast
MPKGRIKIEP ITNSSARNQT FRKRKKCLLK KANELSTLCG VKVCAVINSC DNTEPPEFWP  60
SKEGAEKVHS AFMGVLPEER CKRMYDQERI QKGQDPERTR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12125RKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013617898.16e-70PREDICTED: MADS-box transcription factor PHERES 1-like
SwissprotO808054e-21PHE1_ARATH; MADS-box transcription factor PHERES 1
TrEMBLA0A0D3AXF06e-70A0A0D3AXF0_BRAOL; Uncharacterized protein
STRINGBra020552.1-P2e-49(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14795620
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65330.13e-22M-type_MADS family protein