PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013617877.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 270aa    MW: 29921.2 Da    PI: 4.3295
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013617877.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF36.65.6e-122163244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    + e k +r v +skRr++++ K  EL+ L +a++av + s+ +
  XP_013617877.1 21 KCETKEQRAVAYSKRRKTLFSKSAELCCLSGANIAVFVTSPGD 63
                    568899********************************99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.8E-171271IPR002100Transcription factor, MADS-box
PROSITE profilePS5006613.9181272IPR002100Transcription factor, MADS-box
CDDcd002668.87E-211376No hitNo description
SuperFamilySSF554557.19E-1614103IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-71434IPR002100Transcription factor, MADS-box
PfamPF003191.3E-102364IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-73449IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-74970IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MFLDWSTMAR GGTKRKIEIK KCETKEQRAV AYSKRRKTLF SKSAELCCLS GANIAVFVTS  60
PGDKANVASS FSGHASATEI VDCYFKGTLP PKISVPESKL GLWWTDPDLY SSCDDLSQLD  120
VIEDLIKRTK KDLMDCLEKQ ENSRVCCFDS RQNPNSSSQA VTMYQNTSKP LDGSSQVIYG  180
GESSSGQPRY LVNKDVGNCL WETEKENNLI MSLPQETEQT QSITNVEGGD EGQSFWDELY  240
NEDGFGLNNG EDDVMIDIGE FLNDIESGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013617877.10.0PREDICTED: uncharacterized protein LOC106324460
TrEMBLA0A0D3AX690.0A0A0D3AX69_BRAOL; Uncharacterized protein
STRINGBra020600.1-P1e-178(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63951442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G48150.16e-75M-type_MADS family protein