PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013615644.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 183aa    MW: 20924.7 Da    PI: 8.2084
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013615644.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.3e-2382170797
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                      +++l+ + l lp++f++++g++++++ +++l++e+g+sW++ l  +k sg++++++GW++F++an Lk+g + +Fkl++ s++++v+++f
  XP_013615644.1  82 WPSSLRYDTLNLPRSFVRSNGLETRCGGEIVLMNEKGKSWTLAL-KQKLSGSTYIRRGWRRFCSANVLKTGGVYTFKLIH-SGRTPVLRLF 170
                     567888999***********************************.5888899**************************99.8888999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100171.39E-7134No hitNo description
Gene3DG3DSA:2.40.330.102.7E-16150IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.166137IPR003340B3 DNA binding domain
SuperFamilySSF1019362.16E-10144IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.1E-2169167IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019368.63E-2171168IPR015300DNA-binding pseudobarrel domain
CDDcd100174.56E-1876170No hitNo description
PROSITE profilePS5086314.73476173IPR003340B3 DNA binding domain
SMARTSM010197.4E-2777173IPR003340B3 DNA binding domain
PfamPF023628.1E-2282170IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
TDGWKEFAIA HDLRIGDILI FRQEKDMAFH VTLLGPSGCE FQYESCSEEE NNLGRNIPKK  60
KNLEREAESS SLDPSCFLAT IWPSSLRYDT LNLPRSFVRS NGLETRCGGE IVLMNEKGKS  120
WTLALKQKLS GSTYIRRGWR RFCSANVLKT GGVYTFKLIH SGRTPVLRLF FTESESESEE  180
RNF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013615644.11e-134PREDICTED: B3 domain-containing protein REM14-like, partial
SwissprotO230763e-69REM15_ARATH; Putative B3 domain-containing protein REM15
TrEMBLM4ETE41e-119M4ETE4_BRARP; Uncharacterized protein
STRINGBra032075.1-P1e-118(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.14e-69B3 family protein