PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013614698.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 750aa    MW: 83895.7 Da    PI: 5.0798
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013614698.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS372.36.4e-1143757451373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++lL+ cA+avs +d + a+++L +++e++sp g+  +Rla+yf++ L+arla++++++y al++++ts    ++ l+a++++  v+P+ k + 
  XP_013614698.1 375 LRTLLVLCAQAVSVDDRRTANEMLRQIREHSSPLGNGSERLAHYFANSLEARLAGTGTQIYTALSSKKTS---AADMLKAYQTYISVCPFKKAAI 466
                     5789**************************************************************9999...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN+ I++ +++++++Hi+Df+is+G+QWpaL++ L+ Rp+gpp+lRiTg++ p+ g   +e ++etg rLa+++++ +vpfe+n+ +a+++e+
  XP_013614698.1 467 IFANHSIMRLTANADTIHIVDFGISYGFQWPALIHRLSFRPGGPPKLRITGIELPQRGfrPAEGVHETGLRLARYCQRYKVPFEYNA-IAQKWET 560
                     ********************************************************99*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++e+L++++gE ++Vn+ ++ ++llde+v ++s+rd+vLkl+++ +P v++ +    ++n++ F++rf eal +ysalfd+ ++kl+re+e r 
  XP_013614698.1 561 IRVEDLKIEQGEFVVVNSLFRFKNLLDETVVVNSPRDAVLKLIRKANPSVFIQAVLSGSYNAPFFVTRFREALFHYSALFDMCDSKLAREDEMRL 655
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                     + E+e+ grei+nvvaceg+er+er et+++W++r+ +aGFk++pl+++ +++ kl +++ +++ + ++++ ++l++gWk+r +++ S+W
  XP_013614698.1 656 MFEKEFYGREIMNVVACEGTERVERPETYKQWQARVIRAGFKQLPLEKELMQNLKLKIENGYDKNFDIDQDGNWLLQGWKGRIVYASSVW 745
                     **************************************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.436349726IPR005202Transcription factor GRAS
PfamPF035142.2E-111375745IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 750 aa     Download sequence    Send to blast
MGSYSGGSLD GFDFTSEFDN LPASNQTVDL SDGFYLDDPL LNFVSFDHSS APPPEPYPQK  60
ENSNNNNAAA ETASGDRLSS PSDDSEFSDS VLKYISQVLM EEDMEEKPCM FHDALALQAA  120
EKSLYEALGE QYPSSMDHGA SYPEKLAEDS PDGSFPSGGG FSDYASTTTS SDSHWSLDGL  180
ENNNRPSWLQ TPFPSNFVFQ STSRSTSGGN SASFGSSMFK DSELAMQFKR GVDEASKFLP  240
KSSQLFIDVE SYVPKNSGFD ENTSEVFVKT EKKDEAEHPP PPPSNSRLTG KKKSHWRDED  300
EDLAEERSNK QSAVYVEETE LSEMFDKILL CGGTGQPVCI TDQKFPTEAK ARGKKSTATT  360
TNSNSKGSKK ETADLRTLLV LCAQAVSVDD RRTANEMLRQ IREHSSPLGN GSERLAHYFA  420
NSLEARLAGT GTQIYTALSS KKTSAADMLK AYQTYISVCP FKKAAIIFAN HSIMRLTANA  480
DTIHIVDFGI SYGFQWPALI HRLSFRPGGP PKLRITGIEL PQRGFRPAEG VHETGLRLAR  540
YCQRYKVPFE YNAIAQKWET IRVEDLKIEQ GEFVVVNSLF RFKNLLDETV VVNSPRDAVL  600
KLIRKANPSV FIQAVLSGSY NAPFFVTRFR EALFHYSALF DMCDSKLARE DEMRLMFEKE  660
FYGREIMNVV ACEGTERVER PETYKQWQAR VIRAGFKQLP LEKELMQNLK LKIENGYDKN  720
FDIDQDGNWL LQGWKGRIVY ASSVWVPSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-5238274926382Protein SCARECROW
5b3h_A3e-5238274925381Protein SCARECROW
5b3h_D3e-5238274925381Protein SCARECROW
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1290294KKKSH
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013614698.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013614698.10.0PREDICTED: scarecrow-like protein 14
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A0D2ZTP90.0A0A0D2ZTP9_BRAOL; Uncharacterized protein
STRINGBo01118s010.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]