PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613894.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 676aa    MW: 75889.6 Da    PI: 7.7604
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613894.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4211e-1283026701373
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfs 94 
                     lv+lL+ c ea+++++ +++++++ar  elasp+g +pm+Rl+ay+teALa r+ar++++++++ pp++ +    +e+++al+++++v+Pi+kf 
  XP_013613894.1 302 LVNLLTGCLEAIRTRNIAAINHFIARTGELASPRGtTPMTRLIAYYTEALALRVARMWPHIFHITPPRDFE----DESANALRFLNQVTPIPKFI 392
                     6899*******************************99********************************96....89999*************** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h taN+++l+a+eg+ervHiiDfdi+qGlQWp+++q+LasRp++p ++RiTgvg+    sk+el+etg+rL+ fAe+++++f+f++ v++rled+
  XP_013613894.1 393 HYTANSMLLRAFEGKERVHIIDFDIKQGLQWPSFFQSLASRPNPPRHVRITGVGE----SKHELNETGDRLHGFAEAMHLQFQFHP-VVDRLEDV 482
                     *******************************************************....9**************************.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +l++L+vk+gEa+aVn+v q+h++l + +  +   ++++ lv+s++P  vv++eqea+hns ++ +r++++l+yysa+fd +++ l+++s  r+k
  XP_013613894.1 483 RLWMLHVKEGEAVAVNCVSQMHKTLYDGTGAAV--RDFVGLVRSTNPVAVVIAEQEAEHNSVQLETRVFNSLKYYSAVFDVMHKRLGADSLMRVK 575
                     ************************977766666..89********************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdg..yrve...eesgslvlgWkdrpLvsvSaW 373
                     +E++l+grei+++vaceg++r+erh  +++Wr++le+ GF ++ +se+++ q k+llr+++ +d+  ++ve   e+ g ++l W d+pL++vSaW
  XP_013613894.1 576 IEEVLFGREIRSIVACEGSHRQERHVGFGQWRRMLEQLGFMSLGVSEREVFQSKMLLRMYGdGDEefFNVErsdEDGGGVTLRWLDQPLYTVSAW 670
                     *************************************************************6555889**97766678888************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.015276645IPR005202Transcription factor GRAS
PfamPF035143.5E-126302670IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MENRNGEPGL QSLFXQRRRS SSSTTASSVH DDRMLAGCSS SSLLSPTRRL RSEAAAATSS  60
AVSVHFPMNT QRLDLPCSSS NFPRKETPSS RPLGRSISLD NINSNNNNNN KTGGCSLKQS  120
IKLPPLATTR GNADGFSWNN DNNNNREKKS LKRLAEDKED ESCLSRVKRQ RGETGDEHNM  180
GFWFDHFTPA SLPFSLTCSG DNDEKLISTQ PLRGHPHWVN SVITELAGLG DKDIESNRPA  240
SGSSTSASAE SHSFRHRVPE PTNGSRHPYT QHGGSAERRT IENINNNNNN NHRNDTQRDL  300
ELVNLLTGCL EAIRTRNIAA INHFIARTGE LASPRGTTPM TRLIAYYTEA LALRVARMWP  360
HIFHITPPRD FEDESANALR FLNQVTPIPK FIHYTANSML LRAFEGKERV HIIDFDIKQG  420
LQWPSFFQSL ASRPNPPRHV RITGVGESKH ELNETGDRLH GFAEAMHLQF QFHPVVDRLE  480
DVRLWMLHVK EGEAVAVNCV SQMHKTLYDG TGAAVRDFVG LVRSTNPVAV VIAEQEAEHN  540
SVQLETRVFN SLKYYSAVFD VMHKRLGADS LMRVKIEEVL FGREIRSIVA CEGSHRQERH  600
VGFGQWRRML EQLGFMSLGV SEREVFQSKM LLRMYGDGDE EFFNVERSDE DGGGVTLRWL  660
DQPLYTVSAW SVGGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A5e-6230967126379Protein SCARECROW
5b3h_A5e-6230967125378Protein SCARECROW
5b3h_D5e-6230967125378Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots and sepals. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013613894.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894370.0AC189437.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB069A23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613894.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 28
SwissprotQ9CAN30.0SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A0D2ZR640.0A0A0D2ZR64_BRAOL; Uncharacterized protein
STRINGBo00795s120.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM72962743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.10.0GRAS family protein