PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013613614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 342aa    MW: 39314.7 Da    PI: 9.9229
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013613614.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.61.6e-23655251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +++++s + +++s+R+++i+KKA+ELS+LC++ v vi+++++g+l+++++
  XP_013613614.1  6 SSSSNSLAATSLSNRLKTIFKKASELSILCQVAVNVIYYGPNGELKTWPK 55
                    78999*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004320.0024456IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-131584IPR002100Transcription factor, MADS-box
PfamPF003197.3E-131553IPR002100Transcription factor, MADS-box
PROSITE profilePS5006610.3161557IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRASSSSSSN SLAATSLSNR LKTIFKKASE LSILCQVAVN VIYYGPNGEL KTWPKEKEVV  60
KDMALRYKAA TKRKKSSNLR DFLEGKLEND KNLKKNKKKT KREFENVKYP EWYPVLDHYS  120
PDQLHELVLS LQGTLSTMEE RIRVLEAKKQ KNTNLVHQNL TQQRHHQHQT VQPLNPSQYS  180
LYLFNRDDAT LSQLPLSASH SKQLISYQNQ LRMQQQRLYD PCVSNTQGHP ALLTVQESWL  240
KNQLMQQQEP YGSHHNMRTM NNTTNSKVLG HPCPLNTIPK EFSFDLQKNP NDDMVGRPKF  300
SQDMLNLCLA YADSPQLQTS SLPSIHQTIP NINLIPDNSR CL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
193101KKNKKKTKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013613614.10.0PREDICTED: agamous-like MADS-box protein AGL93
TrEMBLA0A0D2ZQ370.0A0A0D2ZQ37_BRAOL; Uncharacterized protein
STRINGBra031864.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM56620126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65330.12e-84AGAMOUS-like 78