PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013612911.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 507aa    MW: 55827.1 Da    PI: 5.3249
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013612911.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS441.65.7e-1351465021374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl.fsevsPilkfs 94 
                     lv++Ll+cAeav++++l+la+ l+++l  las+++ +m+++a+yf+e+La+r++r    +y   p+ +   ++ s++l+   + f+e++P+lkf+
  XP_013612911.1 146 LVHALLACAEAVQQNNLKLADVLVKHLGLLASSQAGAMRKVATYFAEGLARRIYR----IY---PSDDVGLSSFSDTLQ---VhFYECCPYLKFA 230
                     689****************************************************....55...333333222344433...34*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+taNqaIlea++++e+vH+iD++++qGlQWpaL+qaLa Rp+gpp +R+Tg+gs  s   ++++e+g++L ++A+++gv+fef+ +v ++l+dl
  XP_013612911.1 231 HFTANQAILEAFATAEKVHVIDLGLNQGLQWPALIQALALRPGGPPDFRLTGIGS--SLTGQSIQEVGWKLGQLANAVGVNFEFKSIVLNSLSDL 323
                     *******************************************************..5699********************************** PP

            GRAS 190 eleeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     + e+L++++  E++aVn+v++lhrll++++s+++    +L ++ks++P++++vveqea+hn++ Fl+rf+e+l+yys+lfdsle      s++++
  XP_013612911.1 324 KQEMLEIRTgSESIAVNSVFELHRLLAHPGSIDN----ILLTIKSIKPDIITVVEQEANHNGAVFLDRFTESLHYYSSLFDSLEGP----SSQDR 410
                     *********99******************99999....**********************************************99....89999 PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++++ +lgr+i n+vaceg++r+erhetl++Wr+r+++ GFk+v+++++a+kqa++ll+ ++  dgy+vee++g+l+lgW++rpL+++SaWr
  XP_013612911.1 411 VMSELYLGRQILNLVACEGEDRVERHETLAQWRNRFTMGGFKSVSIGSYAYKQASMLLALYAgADGYKVEENEGCLLLGWQTRPLIATSAWR 502
                     999999*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011293.1E-3531100No hitNo description
PfamPF120411.0E-313193IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098566.368120481IPR005202Transcription factor GRAS
PfamPF035142.0E-132146502IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0042538Biological Processhyperosmotic salinity response
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MKREHGHRET SSVKAGSSSM TANKEEAGGF DELLVVLGYK VRSSDMADVA HKLEQLEMVL  60
DDGNSHLSDD TVHYNPSDLS GWVDSLLFDL NPTCDQVIPD QDSEYELSAI PGSAAYPRGK  120
RTRTGSNSST TRSMVVLDSQ ETGVRLVHAL LACAEAVQQN NLKLADVLVK HLGLLASSQA  180
GAMRKVATYF AEGLARRIYR IYPSDDVGLS SFSDTLQVHF YECCPYLKFA HFTANQAILE  240
AFATAEKVHV IDLGLNQGLQ WPALIQALAL RPGGPPDFRL TGIGSSLTGQ SIQEVGWKLG  300
QLANAVGVNF EFKSIVLNSL SDLKQEMLEI RTGSESIAVN SVFELHRLLA HPGSIDNILL  360
TIKSIKPDII TVVEQEANHN GAVFLDRFTE SLHYYSSLFD SLEGPSSQDR VMSELYLGRQ  420
ILNLVACEGE DRVERHETLA QWRNRFTMGG FKSVSIGSYA YKQASMLLAL YAGADGYKVE  480
ENEGCLLLGW QTRPLIATSA WRFNRVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A9e-6814150113377Protein SCARECROW
5b3h_D9e-6814150113377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in germinating seeds and flowers and siliques. Highly expressed in inflorescences and weakly or not expressed in rosette leaves, etiolated seedlings, siliques, mature stems and roots. RGA and GAI transcripts were detected at slightly varying levels in all tissues examined. RGL2 signal was undetected, and RGL3 signal was very weak in all tissues examined (rosette leaves, seedlings, inflorescences, and siliques) except inflorescences. In the flower, it is expressed in developing ovules as well as in developing anthers throughout microspore development. {ECO:0000269|PubMed:11826301}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Has overlapping but distinct roles in GA signaling compared to RGA and GAI. Regulates the floral development. May also participate in seed germination and in ovule and anther development. Its activity is probably regulated by other phytohormones such as auxin and ethylene. {ECO:0000269|PubMed:11826301, ECO:0000269|PubMed:11877383, ECO:0000269|PubMed:12610625, ECO:0000269|PubMed:14615596, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013612911.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated upon GA treatment.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612911.10.0PREDICTED: DELLA protein RGL1
RefseqXP_013722503.10.0DELLA protein RGL1
SwissprotQ9C8Y30.0RGL1_ARATH; DELLA protein RGL1
TrEMBLA0A078IXQ00.0A0A078IXQ0_BRANA; BnaCnng28010D protein
TrEMBLA0A0D3AND10.0A0A0D3AND1_BRAOL; Uncharacterized protein
TrEMBLA0A3P6DCS50.0A0A3P6DCS5_BRAOL; Uncharacterized protein
STRINGBo2g052880.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.10.0RGA-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yan A, et al.
    AtEXP2 is involved in seed germination and abiotic stress response in Arabidopsis.
    PLoS ONE, 2014. 9(1): p. e85208
    [PMID:24404203]
  3. Gallego-Giraldo C, et al.
    Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis.
    Plant J., 2014. 79(6): p. 1020-1032
    [PMID:24961590]
  4. Fukazawa J, et al.
    DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis.
    Plant Cell, 2014. 26(7): p. 2920-38
    [PMID:25035403]
  5. Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
    Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling.
    Nat Plants, 2016. 2: p. 16013
    [PMID:27249348]
  6. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  7. Li Y,Wang H,Li X,Liang G,Yu D
    Two DELLA-interacting proteins bHLH48 and bHLH60 regulate flowering under long-day conditions in Arabidopsis thaliana.
    J. Exp. Bot., 2017. 68(11): p. 2757-2767
    [PMID:28591805]
  8. Chen L,Xiang S,Chen Y,Li D,Yu D
    Arabidopsis WRKY45 Interacts with the DELLA Protein RGL1 to Positively Regulate Age-Triggered Leaf Senescence.
    Mol Plant, 2017. 10(9): p. 1174-1189
    [PMID:28735023]
  9. Zhang L,Chen L,Yu D
    Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering.
    Plant Physiol., 2018. 176(1): p. 790-803
    [PMID:29133369]