PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013612889.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 495aa    MW: 55676.6 Da    PI: 7.0223
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013612889.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS452.52.8e-1381254952374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +  L++cA+a+s++dl +a++++++l+ ++s +g+p+qRl ay++e+L a+la+s+s++yk+l+  +++   s e l+++++++ev+P++kf+++
  XP_013612889.1 125 RADLVSCAKAMSENDLMMANSMMEKLRLMVSVSGEPIQRLGAYLLEGLVAQLASSGSSIYKSLNRCPEP--ASNELLSYMHILYEVCPYFKFGYM 217
                     678************************************************************666665..49999******************* PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                      aN aI ea+++e+rvHiiDf+i+qG QW++L+qa+a+Rp+gpp +RiTg+++++s   +   l+ +g+rLak+A++++vpfefn  v+ +++++
  XP_013612889.1 218 SANGAIAEAMKNENRVHIIDFQIGQGSQWVTLIQAFAERPGGPPWIRITGIDDMASAyaRGGGLSIVGNRLAKLAKKFNVPFEFNS-VSVSVAEV 311
                     *****************************************************999899999************************.7999**** PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++++L v++gEalaVn+++ lh+++desvs+e++rd++L++vk+lsPkvv++veqe+++n++ F+ rf+e+++yy a+f+s++++lpr++++ri+
  XP_013612889.1 312 KPNNLGVRTGEALAVNFAFVLHHMPDESVSTENHRDRLLRMVKGLSPKVVTLVEQESNTNTAAFFPRFMETMDYYDAMFESIDVTLPRNHKQRIN 406
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     vE+++l+r++vn++acega+r+erhe l+kWr r+++aGF+p+pls  +++++k+llr+++++ yr+ee++g+l+lgW++r Lv+ +aW+
  XP_013612889.1 407 VEQHCLARDVVNIIACEGADRVERHELLGKWRLRFGMAGFTPYPLSPLVNSTIKRLLRNYSDK-YRLEERDGALYLGWMKRDLVASCAWK 495
                     *************************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.69398476IPR005202Transcription factor GRAS
PfamPF035149.7E-136125495IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 495 aa     Download sequence    Send to blast
MYKHPRQEIE AYSLPPFEAN SVGKLRYIPV NNSRKRYCML EPSSSSPDST VLVSNNNNNS  60
THEDTSASCV TDDFNDKIKE LETAMMGPDC LDLALYYNDS FVSTPCQVTN SWRSTLEAVS  120
RRDLRADLVS CAKAMSENDL MMANSMMEKL RLMVSVSGEP IQRLGAYLLE GLVAQLASSG  180
SSIYKSLNRC PEPASNELLS YMHILYEVCP YFKFGYMSAN GAIAEAMKNE NRVHIIDFQI  240
GQGSQWVTLI QAFAERPGGP PWIRITGIDD MASAYARGGG LSIVGNRLAK LAKKFNVPFE  300
FNSVSVSVAE VKPNNLGVRT GEALAVNFAF VLHHMPDESV STENHRDRLL RMVKGLSPKV  360
VTLVEQESNT NTAAFFPRFM ETMDYYDAMF ESIDVTLPRN HKQRINVEQH CLARDVVNII  420
ACEGADRVER HELLGKWRLR FGMAGFTPYP LSPLVNSTIK RLLRNYSDKY RLEERDGALY  480
LGWMKRDLVA SCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-631284958375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013612889.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893050.0AC189305.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB031O20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612889.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013612890.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013612891.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_013612892.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0D3E0S10.0A0A0D3E0S1_BRAOL; Uncharacterized protein
STRINGBo9g009260.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]