PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013612003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 374aa    MW: 42226.4 Da    PI: 7.086
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013612003.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.91.5e-191053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    + en+  rq tf+kR+ngilKKA+ELS+LCd++  +++fs+ gk
  XP_013612003.1 10 KLENTNGRQATFAKRKNGILKKANELSILCDIDLILLMFSPGGK 53
                    6799************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006623.605153IPR002100Transcription factor, MADS-box
SMARTSM004324.1E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.1E-24293IPR002100Transcription factor, MADS-box
CDDcd002661.83E-24284No hitNo description
PRINTSPR004046.3E-17323IPR002100Transcription factor, MADS-box
PfamPF003194.1E-181154IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MGRVKLKIKK LENTNGRQAT FAKRKNGILK KANELSILCD IDLILLMFSP GGKPSLCCGR  60
RSSIEEVIAK FSQVTPEERT KKKVESLETL KKTFLKLDHT VNIRELIASS NSTTERFSQD  120
LSTQASILQA RISEIHGRLS YWTELDKINN VDHLGQLEIS VRQSLDQLRA HKEHLGQQQQ  180
QAMQLENANF VKDWSTCSLQ DGIEIPLEQQ LQSMSWILNS DNTTNIITEE HNPIPKREVE  240
CSASSSFGSY PGYFGTGKSS ETSFLDELNT TNGDIKPQLC TNNNIIPYNS NIMQNDIKHH  300
QTYPPPLPHP PVFNLPSNQR EYHMNGFFEA PPQPNGTSTY NNNNHNQARF GSSSSSLPCS  360
ISMLDEYLFS QQPN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013612003.10.0PREDICTED: agamous-like MADS-box protein AGL14 isoform X2
SwissprotQ1PFA40.0AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A0D3E7M10.0A0A0D3E7M1_BRAOL; Uncharacterized protein
STRINGBra017404.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.21e-162AGAMOUS-like 30