PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013611820.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 601aa    MW: 67854.7 Da    PI: 6.1705
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013611820.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS390.42e-1192145881374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfs 94 
                     l++lL++cA+av+s d+++a++ L++++ ++s++gd +qRla+yf+eAL+ar+++  ++ l+ a+p+s+ts   +++ l+a+klf++v+Pi+   
  XP_013611820.1 214 LRSLLTQCAQAVASFDHRRATEKLKEIRSNSSNSGDGIQRLAFYFAEALEARITGiISPPLCTAFPSSTTS---MVDILKAYKLFVHVCPIYVAD 305
                     6899***************************************************8889999999999998...********************* PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrle 187
                     +++aN+ I+e + +++++HiiDf++ +G+QWp+Ll aL++Rp+gpp+lR+Tg++ p+sg   ++++eetg+rL++f++ ++vpfefn+ +ak++e
  XP_013611820.1 306 YFAANKSIYELALNSTKLHIIDFGVLYGFQWPCLLLALSKRPGGPPKLRVTGIELPQSGfrPSDRVEETGRRLKRFCDMFNVPFEFNF-IAKKWE 399
                     **********************************************************9*****************************.7***** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres..e 280
                     +++l+e+ + pgE+++Vn++++l++++de+vsl+s+rd+vLkl+++++P+++v++e +  +ns+ F++rf eal ++s+lfd++++++ +e+  +
  XP_013611820.1 400 SITLDEITIIPGETTVVNCIHRLQYTPDETVSLDSPRDTVLKLFRDINPDLFVFAEINGTYNSPFFMTRFKEALFHFSSLFDMFDTTIQAEDeyK 494
                     ***************************************************************************************99998899 PP

            GRAS 281 erikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +r+ +Erell r++++v++ egaer++r et+++Wr rl +aGF+p+ +s ++ k ak ++rk + + + ++ + +++++gWk+r ++++S+Wr
  XP_013611820.1 495 NRALLERELLVRDAMSVISSEGAERFARPETYKQWRVRLLRAGFRPAMISREILKGAKEIVRKRYHKDFLIDGDGNWMLQGWKGRVIYAFSCWR 588
                     *****************************************************************888*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.51188568IPR005202Transcription factor GRAS
PfamPF035146.8E-117214588IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MDALLQVSVD GFRFDGSGSG SCCKPRNNLE TQNQSSPPTD SPPSICQDNA PVLKYINDML  60
MDEEDFVEDN LALEAAERSF HELLHQPPPS ESSDQNLTSS GDQDCSFPST TTTTTDSAGS  120
LVSNGESQRK YRHRNDEEDD LENGRRNKQP AIFVSEMEEL AAKFEHVLLV CKSNQEDSSS  180
STTTTTKKQN PPPPNKAAGR AKGSKAIKSN AVDLRSLLTQ CAQAVASFDH RRATEKLKEI  240
RSNSSNSGDG IQRLAFYFAE ALEARITGII SPPLCTAFPS STTSMVDILK AYKLFVHVCP  300
IYVADYFAAN KSIYELALNS TKLHIIDFGV LYGFQWPCLL LALSKRPGGP PKLRVTGIEL  360
PQSGFRPSDR VEETGRRLKR FCDMFNVPFE FNFIAKKWES ITLDEITIIP GETTVVNCIH  420
RLQYTPDETV SLDSPRDTVL KLFRDINPDL FVFAEINGTY NSPFFMTRFK EALFHFSSLF  480
DMFDTTIQAE DEYKNRALLE RELLVRDAMS VISSEGAERF ARPETYKQWR VRLLRAGFRP  540
AMISREILKG AKEIVRKRYH KDFLIDGDGN WMLQGWKGRV IYAFSCWRPA EKLTRDDHII  600
I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-432145885375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Highly expressed in roots and at lower levels in leaves and sepals. Expressed in siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013611820.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611820.10.0PREDICTED: scarecrow-like protein 11
SwissprotQ9LTI50.0SCL11_ARATH; Scarecrow-like protein 11
TrEMBLA0A0D3ECS50.0A0A0D3ECS5_BRAOL; Uncharacterized protein
STRINGBo9g139410.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36462561
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59450.10.0GRAS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]