PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013611782.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 569aa    MW: 62399.4 Da    PI: 5.1562
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013611782.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS446.51.8e-1362045641374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset.seknsseelaalklfsevsPilkfs 94 
                     lv++L++cAea++++dl+ a+al++++  la +++ +m+++a+yf+eALa+r++r        l+p +t  +++ s++l++   f+e++P+lkf+
  XP_013611782.1 204 LVHALMACAEAIQNNDLSIAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYR--------LSPPQTqIDHSLSDTLQM--HFYETCPYLKFA 288
                     689****************************************************........444444043445555444..5*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+taNqaIlea+eg++rvH+iDf+++qGlQWpaL+qaLa R++gpp +R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++ +va++l+dl
  XP_013611782.1 289 HFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPVFRLTGIGPPAADNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADL 383
                     *********************************************************************************************** PP

            GRAS 190 eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     + ++L+++p   Ea+aVn+v++lh+ll +++ +e+    vL +vk+++P +++vveqe++hn++ Fl+rf+e+l+yys+lfdsle      s+++
  XP_013611782.1 384 DASMLELRPseIEAVAVNSVFELHKLLGRTGGIEK----VLGVVKQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGV---PSSQD 471
                     ********98889**************99999999....*********************************************998...69999 PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++++++lg++i+n+vaceg +r+erhetl++W +r++++GF p++l+++a kqa++ll+ ++ ++gy+vee++g+l+lgW++rpL+++SaW+
  XP_013611782.1 472 KVMSEVYLGKQICNLVACEGPDRVERHETLSQWANRFGTSGFAPAHLGSNAFKQASMLLALFNgGEGYSVEENNGCLMLGWHTRPLITTSAWK 564
                     ********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120415.1E-3545112IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011292.0E-3945118No hitNo description
PROSITE profilePS5098565.379178543IPR005202Transcription factor GRAS
PfamPF035146.2E-134204564IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 569 aa     Download sequence    Send to blast
MKRDLHQFQG PPDTRFPNHE TANTGSSSKD KMMKVKEEED GGNMDELLAV LGYKVRSSEM  60
AEVALKLEQL ETMMGNVQED GLSNLATDTV HYNPSELYSW LDNMLTEFNP PPPEINNSFL  120
AGAGGSDYDL KAIPGNAIYA RSNQFAIDSS SSSNQAGDNS QSTKRLKSCS SPDSLVTGTT  180
VTTTTIESTR SMVLVDSQEN GVRLVHALMA CAEAIQNNDL SIAEALVKQI GFLAVSQAGA  240
MRKVATYFAE ALARRIYRLS PPQTQIDHSL SDTLQMHFYE TCPYLKFAHF TANQAILEAF  300
EGKKRVHVID FSMNQGLQWP ALMQALALRE GGPPVFRLTG IGPPAADNSD HLHEVGCKLA  360
QLAEAIHVEF EYRGFVANSL ADLDASMLEL RPSEIEAVAV NSVFELHKLL GRTGGIEKVL  420
GVVKQIKPVI FTVVEQESNH NGPVFLDRFT ESLHYYSTLF DSLEGVPSSQ DKVMSEVYLG  480
KQICNLVACE GPDRVERHET LSQWANRFGT SGFAPAHLGS NAFKQASMLL ALFNGGEGYS  540
VEENNGCLML GWHTRPLITT SAWKLLAAH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A5e-6419956313377Protein SCARECROW
5b3h_D5e-6419956313377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013611782.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB3319190.0AB331919.1 Brassica oleracea var. italica BoGAI mRNA for GRAS family transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013611782.10.0PREDICTED: DELLA protein RGA2 isoform X1
RefseqXP_013611783.10.0PREDICTED: DELLA protein RGA2 isoform X2
SwissprotQ5BN220.0RGA2_BRACM; DELLA protein RGA2
TrEMBLB1Q3A50.0B1Q3A5_BRAOT; GRAS family transcription factor
STRINGBo9g070200.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein