PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013610790.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 189aa    MW: 21449.7 Da    PI: 9.5631
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013610790.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.83.2e-141361149
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    k++e++  r +tfskRr+gilKK +E+   Cd+e++ + fs++g   ++
  XP_013610790.1 13 KKVESYEARRTTFSKRRAGILKKMNEIIAVCDVEASFLGFSESGYPLTF 61
                    5789***************************************977776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.5E-16564IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.184565IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-19576IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-12727IPR002100Transcription factor, MADS-box
PfamPF003191.2E-131461IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-122742IPR002100Transcription factor, MADS-box
PRINTSPR004044.7E-124263IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 189 aa     Download sequence    Send to blast
MKHTKGKQKI EMKKVESYEA RRTTFSKRRA GILKKMNEII AVCDVEASFL GFSESGYPLT  60
FAHPSMEDAV DRVKCSLGHE PSGKDDASVG SLVEAYKRQK NEELKKNLCD LAEELKMVKE  120
KEKKMVEKKK IKESKNEWSN ILNEGVNKDE LKRVHQAFVE LNYSLSGKAL QRLGKDGDGS  180
SCSCRTWTL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013610790.11e-137PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLA0A0D3E2411e-137A0A0D3E241_BRAOL; Uncharacterized protein
STRINGBra037759.1-P2e-90(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04100.16e-42AGAMOUS-like 57