PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013608797.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 485aa    MW: 53817.9 Da    PI: 7.2943
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013608797.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.82.6e-14111149241
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++k+CnCk+skClk+YCeCfa+g++C+  C+C +C+N+ e
  XP_013608797.1 111 KQKHCNCKNSKCLKLYCECFASGSYCNG-CNCLNCQNNLE 149
                     79**************************.********977 PP

2TCR51.42.1e-16195234140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeC++a++ Cse+CkC+dCkN e
  XP_013608797.1 195 KHSKGCHCKKSGCLKKYCECYQANVLCSENCKCQDCKNFE 234
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-16110150IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.769111235IPR005172CRC domain
PfamPF036388.3E-11112147IPR005172CRC domain
SMARTSM011144.4E-19195236IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-12198233IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MDNSDQDLGS PRNQLARRLD FSVSAAAEMD SSQGSEKHSL LDSNSSREDH KEEDLLPPPP  60
PSGSEEQVVK SLKPPVRSEL STPPQRPPIN GFDHEPAKCR VSKQEPLTPS KQKHCNCKNS  120
KCLKLYCECF ASGSYCNGCN CLNCQNNLEN ETARQEAITG TLDRNPDAFK PKIAGSPLGT  180
KDLQEDARQL LILGKHSKGC HCKKSGCLKK YCECYQANVL CSENCKCQDC KNFEGSQERN  240
ALLYGPETYT QQQQTTNAAL NRAVATSGYL NPLESRKRKS KEASHSAGGS SAFPHLIRNG  300
DTSLFSVPNN RVVSGFTACS YRSSLSNTIQ PRHVKDLCAL LVTRSVDVAN KRRKNEKDSS  360
LDPALRDVNE TNDSPDCVLD STRMDEKPLS PATRALMCDD EDVIISEKET SAARVKTSQE  420
KEDADTSSES FVEQERQILS SFRDFLIQFS NRGNIKRMNI KTKTNQSRKE PPEDEEQRNQ  480
HSGLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A5e-3311224411132Protein lin-54 homolog
5fd3_B5e-3311224411132Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1274279SRKRKS
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013608797.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728830.0AC172883.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH125N23, complete sequence.
GenBankAC1893210.0AC189321.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036J07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608797.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
SwissprotF4JY840.0TCX7_ARATH; Protein tesmin/TSO1-like CXC 7
TrEMBLA0A3P6DP320.0A0A3P6DP32_BRAOL; Uncharacterized protein (Fragment)
STRINGBra036551.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134631628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25790.11e-170Tesmin/TSO1-like CXC domain-containing protein