PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013608279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 296aa    MW: 34394 Da    PI: 8.1903
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013608279.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.89.1e-161153244
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                    ri n+  r +t+ kRr+ + KKA E S+LC+++ ++i+++ t 
  XP_013608279.1 11 RITNDKTRMTTYKKRRACLYKKAGEFSTLCGVQTCIILYGATK 53
                    89*************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.8E-10161IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-7424IPR002100Transcription factor, MADS-box
CDDcd002661.17E-20582No hitNo description
PROSITE profilePS5006614.073762IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.57E-16789IPR002100Transcription factor, MADS-box
PfamPF003192.2E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-72439IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-73960IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAHEKVVDLQ RITNDKTRMT TYKKRRACLY KKAGEFSTLC GVQTCIILYG ATKATDEVIS  60
KPEIWPEDET KARDIIRRYR DTVSNSCRKE AHVETFVNDK GKAKETENTN NNNKRGMNNK  120
NKYCCWEERL EKCSQEQLRG IFDDVGNKLH EAIMRQNRNA ITAQHQVMEP QTPQNLMDPY  180
YVSQYFAGHQ QQQCLMFPYN NMSFPLFSPH DDQIPMEPIL VENFADSGVN QGFMMSKGNE  240
STQFMQRQAP YYIEPVVQRP ASFNVNPFTG YQVPYNIPRL PGNQAEVWDF MAKKPI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608279.10.0PREDICTED: agamous-like MADS-box protein AGL86
SwissprotQ9FIM01e-123AGL82_ARATH; Agamous-like MADS-box protein AGL82
TrEMBLA0A0D3ECK30.0A0A0D3ECK3_BRAOL; Uncharacterized protein
STRINGBra002611.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59481947
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58890.11e-118AGAMOUS-like 82