PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 603aa    MW: 66364.6 Da    PI: 7.8014
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607437.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.5e-16324362240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_013607437.1 324 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 362
                     689**********************************96 PP

2TCR52.31.1e-16409447139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeC+++g+ Cs +C+Ce+CkN 
  XP_013607437.1 409 RHKRGCNCKKSNCLKKYCECYQSGVGCSINCRCEGCKNA 447
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.4E-19323364IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.543324449IPR005172CRC domain
PfamPF036385.6E-12326361IPR005172CRC domain
SMARTSM011144.2E-17409450IPR033467Tesmin/TSO1-like CXC domain
PfamPF036385.5E-12411447IPR005172CRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MDTPQKTVTQ IETPVSKLKV ENSPVFNYIN SLSPITTVKS ISNAQTFSSL SFTSPPPVFT  60
TPHVASHKGS RFRSHSNSSD PSNKVVEEAL LEKEPPQILN NECLTTTPRV TNDGACEYGE  120
TDLQKMCDDN VKRKSDTPDW ETLISDSSDM LIYGSPNDSE AFRCFLQRSS DSKTRLCDGG  180
SKPALVAPVS QSNEPESSDA LSILHRGVRR RCLDFEMPRN NNQTPRCVVP SIGLHLNAIA  240
MSSKDNNNVS KEYSFTGNVK VGLQSSTTPV LPSDDIGRDN EIREAAGVEE APLSLALVEV  300
NQSSPKKKRM CRRKSEQAGE GESSCKRCNC KKSKCLKLYC ECFAAGVYCI EPCSCIDCFN  360
KPIHEDTVLA TRKQIESRNP LAFAPKVIRN SDSTIEVGED ASKTPASARH KRGCNCKKSN  420
CLKKYCECYQ SGVGCSINCR CEGCKNAFGR KDGSSFAGMD TEQDQENETS GKSGTTIPLP  480
PSTPMPLRQP LAQLPISSNN MLPSQQSQQH LHGASLYNSQ SFRKQDMGLM SHSRIETIAE  540
ERAEDIENFI HSPVTNINAL SPNSKRVSLP HMDSTETTHW RRNGGRKLLL SSIPTFPSLT  600
PHH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1732844614120Protein lin-54 homolog
5fd3_B3e-1732844614120Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers and at significant levels in leaves. Detected with highest levels in developing ovules and microspores, and in petals. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00044PBMTransfer from AT3G22760Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013607437.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2051421e-144AF205142.1 Arabidopsis thaliana CXC domain containing TSO1-like protein 1 (SOL1) mRNA, complete cds.
GenBankAY0996531e-144AY099653.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
GenBankAY1288371e-144AY128837.1 Arabidopsis thaliana unknown protein (At3g22760) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607437.10.0PREDICTED: protein tesmin/TSO1-like CXC 3 isoform X1
SwissprotQ8L5480.0TCX3_ARATH; Protein tesmin/TSO1-like CXC 3
TrEMBLA0A0D3ABH90.0A0A0D3ABH9_BRAOL; Uncharacterized protein
STRINGBo1g104900.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.10.0Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]