PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013605972.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 525aa    MW: 57604.9 Da    PI: 4.5386
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013605972.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS430.21.6e-1311565151374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv++L++cAeav++++l la+al++r+  la++++ +m ++a+yf+eALa+r++r        ++ps+ + + s ee+     f+e +P+lkf+h
  XP_013605972.1 156 LVQALVACAEAVQQENLILADALVKRVGSLAASQAGAMGKVATYFAEALARRIYR--------IRPSSPAVDPSFEEILQ-MHFYESCPYLKFAH 241
                     689****************************************************........55555554445555444.46************ PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     +taNqaIleav++++ vH+iD++i+qG+QWpaL+qa+a Rp+g+ps+R+Tgvg p+  + + ++++g++La++A+++gv+fef+ l++++l+dle
  XP_013605972.1 242 FTANQAILEAVATARGVHVIDLGINQGMQWPALMQAMALRPGGSPSFRLTGVGGPS--EGDGIQQLGWKLAQLAQAIGVEFEFKGLTVESLTDLE 334
                     ******************************************************88..99*********************************** PP

            GRAS 191 leeLrvkp.gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     +e+++++p  E+l+Vn+v++lh ll++++s+e+    +L +vk ++P +v+vveqea+hn+  Flerf eal+yys+lfdsle ++   s++r+ 
  XP_013605972.1 335 PEMFETRPeSETLVVNSVFELHPLLARPGSIEK----LLATVKAVKPSIVTVVEQEANHNGVVFLERFNEALHYYSSLFDSLEDGVIIPSQDRV- 424
                     ********9************************....************************************************988887775. PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++++lgr+i nvva+eg++r+erhetl +Wr+rl++aGF pv+l+++a kqa+lll+  + +dgyrv+e++gsl+l W+++pL+++SaW+
  XP_013605972.1 425 MSEVYLGRQILNVVAAEGTDRIERHETLDQWRKRLGSAGFDPVSLGSDAFKQASLLLALSGgGDGYRVDENDGSLMLAWQTKPLIAASAWK 515
                     66677*************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120416.4E-322793IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011294.2E-342799No hitNo description
PROSITE profilePS5098563.821130494IPR005202Transcription factor GRAS
PfamPF035145.5E-129156515IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MKRSHQETSV EEAHSMGKKL EDDNNMDEFL SALGYKVRSS DMADVAQKLE QLEVVLSNDD  60
VLGSNALNDT VHYNPSDLSS WAETMLSELN YYPPSLDLDP TRMCNLTPFS DDNECSSTNS  120
ENNSKRIRLG PWCDSSESTR PVVMLGVDSQ ETGVRLVQAL VACAEAVQQE NLILADALVK  180
RVGSLAASQA GAMGKVATYF AEALARRIYR IRPSSPAVDP SFEEILQMHF YESCPYLKFA  240
HFTANQAILE AVATARGVHV IDLGINQGMQ WPALMQAMAL RPGGSPSFRL TGVGGPSEGD  300
GIQQLGWKLA QLAQAIGVEF EFKGLTVESL TDLEPEMFET RPESETLVVN SVFELHPLLA  360
RPGSIEKLLA TVKAVKPSIV TVVEQEANHN GVVFLERFNE ALHYYSSLFD SLEDGVIIPS  420
QDRVMSEVYL GRQILNVVAA EGTDRIERHE TLDQWRKRLG SAGFDPVSLG SDAFKQASLL  480
LALSGGGDGY RVDENDGSLM LAWQTKPLIA ASAWKVSDVT AERRR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-6015151414378Protein SCARECROW
5b3h_A3e-6015151413377Protein SCARECROW
5b3h_D3e-6015151413377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at very low level. Mainly expressed in germinating seeds and flowers and siliques. Not expressed in other tissues. {ECO:0000269|PubMed:11826301}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Its activity may be regulated by phytohormones such as auxin and ethylene (By similarity). {ECO:0000250, ECO:0000269|PubMed:12610625, ECO:0000269|PubMed:14615596}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013605972.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013605972.10.0PREDICTED: DELLA protein RGL3
RefseqXP_013722368.10.0DELLA protein RGL3
SwissprotQ9LF530.0RGL3_ARATH; DELLA protein RGL3
TrEMBLA0A078FR040.0A0A078FR04_BRANA; BnaC09g40420D protein
TrEMBLA0A0D3EER50.0A0A0D3EER5_BRAOL; Uncharacterized protein
STRINGBo9g160170.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.10.0RGA-like protein 3
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wild M,Achard P
    The DELLA protein RGL3 positively contributes to jasmonate/ethylene defense responses.
    Plant Signal Behav, 2013. 8(4): p. e23891
    [PMID:23425858]
  3. Shi H,Wei Y,Wang Q,Reiter RJ,He C
    Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis.
    J. Pineal Res., 2016. 60(3): p. 373-9
    [PMID:26887824]
  4. Shi H,Liu W,Wei Y,Ye T
    Integration of auxin/indole-3-acetic acid 17 and RGA-LIKE3 confers salt stress resistance through stabilization by nitric oxide in Arabidopsis.
    J. Exp. Bot., 2017. 68(5): p. 1239-1249
    [PMID:28158805]
  5. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]