PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 566aa    MW: 60390.3 Da    PI: 7.4882
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604988.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.82.4e-14112151141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  XP_013604988.1 112 QKKKHCNCKLSRCLKLYCECFASGTYCDG-CNCVNCFNNAD 151
                     589**************************.********987 PP

2TCR51.32.3e-16197235139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k++kgC+Ckks ClkkYCeCf+a++ Cse+C+C +CkN 
  XP_013604988.1 197 KHNKGCHCKKSGCLKKYCECFQANVLCSENCRCLGCKNF 235
                     589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-16112152IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.816113237IPR005172CRC domain
PfamPF036381.5E-10114149IPR005172CRC domain
SMARTSM011141.1E-18197238IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12200235IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 566 aa     Download sequence    Send to blast
MGEGGGGGGD FPPKKDGVSD ESCFPAKKPA TQLDFTGGSD EHSESHTVVT PSVTSPVTTT  60
PSRLHPVARP TLPVVTSQSQ ILNAPISLPK QPESPESRAR PPIVEGRDGT PQKKKHCNCK  120
LSRCLKLYCE CFASGTYCDG CNCVNCFNNA DNEPARRDAV EATLDRNPNA FRPKIASSPH  180
GARDKREEIG EAVLLGKHNK GCHCKKSGCL KKYCECFQAN VLCSENCRCL GCKNFDGSEE  240
RQALFHGEHA SNMAYLQQAA NAAITGAVGS SGFAPFPAPK RRKGQDISFN QATNDSSMHR  300
LGQFQQASNG RTSGPTSGTS PANVARASGN SSAPSKFVYR SLLAEIIQPQ DVNALCSVLV  360
AVAGEAAKTS TDRRNETEKR VEDQTETSLA SCNSQGNKDA SDVEMIATDG NQADGSNGRP  420
LSPATLALMC DEQDSLFMVA AAEPSGSVDT GGCGTNPQGQ SETYAEKERL VLTKFRDCLT  480
RLISYADFKE SKCSYLARSH IQSPSTAPTV TVKTENGIQQ RPPVVNGASL TTTQPTLNKP  540
QLLQLTTTTS THHPHKPPAP EENKDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-3211424611132Protein lin-54 homolog
5fd3_B4e-3211424611132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013604988.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604988.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A3N6TNB90.0A0A3N6TNB9_BRACR; Uncharacterized protein
STRINGBra010348.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein