PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604918.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 533aa    MW: 58806.5 Da    PI: 5.9483
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604918.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS395.36.6e-1211565261374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+e+Lle A+av++gd++ a  ++  l++++s +g+p+qRl ay++e+L+arl +s+ ++y+al+++e +     e ++++ +++e++P+ kf++
  XP_013604918.1 156 LKEVLLEGARAVADGDFATACGFIDVLEQMVSVSGSPIQRLGAYMAEGLRARLEGSGGNIYRALKCNEPT---GRELMSYMGVLYEICPYWKFAY 247
                     5789*****************************************************************9...99999999************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN aIlea++g++r+H+iDf+i qG Q++ L+++La+Rp+gpp lR+Tgv++++s   +   l  +ge+La++A+++gvpfef+  +  +  +
  XP_013604918.1 248 MSANAAILEATAGDNRIHVIDFQIAQGSQYMFLIHELAKRPGGPPLLRVTGVDDSQSYyaRGGGLTLVGEKLANMAKSCGVPFEFHD-AIMSGCE 341
                     ******************************************************998899999************************.7888999 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++ e+L v+pg a++Vn+ + lh+++desvs+e++rd++L+l+ksl P++v++veqe+++n+++Fl rf+++l+yy+a+f+s++a  pr++++ri
  XP_013604918.1 342 VHREHLGVEPGFAVVVNFPFVLHHMPDESVSVENHRDRLLHLIKSLGPRLVTLVEQESNTNTSPFLSRFVQTLDYYTAMFESIDAARPRDEKQRI 436
                     99********************************************************************************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r+ivn++ace++er+erhe l+kWr r+++aGF   p++ +aa  a+ +l+ ++++ y++  ++g+l+l Wk+rp+ ++SaW+
  XP_013604918.1 437 SAEQHCVARDIVNMIACEERERVERHEVLGKWRVRMMMAGFVGWPVGGSAAFAASEMLKGYDKN-YKLGGSEGALYLFWKRRPMATCSAWK 526
                     **************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.497130507IPR005202Transcription factor GRAS
PfamPF035142.3E-118156526IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MQTSQKHHSA AGLHMLYPQP HCSPQFQMID NNNNNGSSKE SFFTLESSTA SGTTLPSYDS  60
PSSVSITSGR SPFSPQGSHS CISDPHPSPE NVYESPLSAA SSYVYDEAGV KSKIRELEET  120
LLSSDPKVEE YSGFSPAAGK SWNWDELLAL TPQLDLKEVL LEGARAVADG DFATACGFID  180
VLEQMVSVSG SPIQRLGAYM AEGLRARLEG SGGNIYRALK CNEPTGRELM SYMGVLYEIC  240
PYWKFAYMSA NAAILEATAG DNRIHVIDFQ IAQGSQYMFL IHELAKRPGG PPLLRVTGVD  300
DSQSYYARGG GLTLVGEKLA NMAKSCGVPF EFHDAIMSGC EVHREHLGVE PGFAVVVNFP  360
FVLHHMPDES VSVENHRDRL LHLIKSLGPR LVTLVEQESN TNTSPFLSRF VQTLDYYTAM  420
FESIDAARPR DEKQRISAEQ HCVARDIVNM IACEERERVE RHEVLGKWRV RMMMAGFVGW  480
PVGGSAAFAA SEMLKGYDKN YKLGGSEGAL YLFWKRRPMA TCSAWKPNPN QIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-561605268375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During development, higher expression levels are detected in young rosette leaves, senescing leaves and petals and sepals at flower stage 15. {ECO:0000269|PubMed:16680434}.
UniprotTISSUE SPECIFICITY: Expressed in roots, hypocotyls, cotyledons, shoot apex, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:16680434, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013604918.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604917.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_013604918.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A078IM700.0A0A078IM70_BRANA; BnaCnng18770D protein
TrEMBLA0A0D3DME20.0A0A0D3DME2_BRAOL; Uncharacterized protein
STRINGBo8g047170.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13