PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604104.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 259aa    MW: 29272.6 Da    PI: 10.3235
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604104.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.61.2e-2163105345
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF   3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                     i+ ++ rqvtfskRr+g++KKA+EL++LC+ae+ +i++s+  k
  XP_013604104.1  63 IKKETHRQVTFSKRRAGLFKKASELCTLCGAEIGIIVYSPAKK 105
                     8999***********************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.8E-3153112IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.29E-2853130IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.59153113IPR002100Transcription factor, MADS-box
CDDcd002652.16E-3454129No hitNo description
PRINTSPR004042.0E-165575IPR002100Transcription factor, MADS-box
PfamPF003191.4E-2462109IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-167590IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-1690111IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
KLPTMKVDLV IMPHTHSNMY INKXFLHQIV QQLKATKTTP XKKTMMSKKK ESMGRQRIPM  60
VKIKKETHRQ VTFSKRRAGL FKKASELCTL CGAEIGIIVY SPAKKPFSFG HPSVESVLDR  120
YLSRNDLSLA QTKKPQGNTA GNCELNMLLT QTVSEVEEEK KKGQAMADVR KGNAARRLVR  180
NWWEGPVDEM NVVQLQVMKC ALEELRKIVV SETNTVPFKE VKEDVFGFLD TNKVTAPSYM  240
NTSSGLSNAY HFGYGNGCF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604104.10.0PREDICTED: LOW QUALITY PROTEIN: agamous-like MADS-box protein AGL61, partial
SwissprotQ4PSU41e-125AGL61_ARATH; Agamous-like MADS-box protein AGL61
TrEMBLA0A0D3DVK41e-162A0A0D3DVK4_BRAOL; Uncharacterized protein
STRINGBra007829.1-P1e-151(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM8628390
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-121AGAMOUS-like 61