PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013604077.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family NF-YC
Protein Properties Length: 182aa    MW: 20412.8 Da    PI: 9.3929
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013604077.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC42.41.6e-13781631398
           NF-YC  13 atdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98 
                     ++d k  ++P+ ri++il++d+   +i  +a  l+ ka elfi  ++  ++  + + k++ ++   ++++v++ + ++fl d v +
  XP_013604077.1  78 VEDAKMIRFPMNRIRRILRSDNSAPQIMQDAVFLVNKATELFIERFSEEAYESSVQDKKKFIHYKHLSSVVSNDERYEFLADCVRE 163
                     6789999***************************************************************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.8E-1884162IPR009072Histone-fold
PfamPF008087.5E-2185148IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.109.6E-2386162IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MVSSKKPNQE KKPRSDGVNK AGGGNTRSSG SKPKKKNTNV QANAKKEPEV HEISESSSSD  60
SAGEARRDEP VKSNGGGVED AKMIRFPMNR IRRILRSDNS APQIMQDAVF LVNKATELFI  120
ERFSEEAYES SVQDKKKFIH YKHLSSVVSN DERYEFLADC VREKLKADVA MEEWERSMTD  180
AG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7971480.0KC797148.1 Brassica napus transcription factor subunit NF-YC10C (NF-YC10C) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013604077.11e-132PREDICTED: DNA polymerase epsilon subunit 4-like
TrEMBLA0A078GBI31e-132A0A078GBI3_BRANA; BnaC08g43430D protein
TrEMBLA0A0D3DYH61e-132A0A0D3DYH6_BRAOL; Uncharacterized protein
STRINGBra031606.1-P1e-108(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM111902231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07980.17e-70nuclear factor Y, subunit C10