PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603746.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 206aa    MW: 23401 Da    PI: 10.0028
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603746.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.13.8e-3529120192
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                     aCa+Ck++r+kC+++C+l+pyfpa+++k+f++vhk+FG+snv+k++++++ee+r+++ +sl++eA +r++dPv G++g +++l+++l+  k+
  XP_013603746.1  29 ACASCKHQRKKCNNECILSPYFPARKSKEFQAVHKVFGVSNVQKMVRTVREEDRTKLSESLTWEALWRQKDPVLGSYGEYRRLSEELKLYKS 120
                     7*************************************************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.9928128IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-3329120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MKERQEGDDM MQRNSNNSNI SHNSPPHQAC ASCKHQRKKC NNECILSPYF PARKSKEFQA  60
VHKVFGVSNV QKMVRTVREE DRTKLSESLT WEALWRQKDP VLGSYGEYRR LSEELKLYKS  120
LVHNQPLVTW NDSNNQQRVF NNSNNNKNGL AVNSSGFGGF SVVNNNGVGV NREIINGGNT  180
SRNLQGGWGN LKQDQRQQCY AVINGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-183011512104LOB family transfactor Ramosa2.1
5ly0_B6e-183011512104LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013603746.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603746.11e-152PREDICTED: LOB domain-containing protein 2-like
SwissprotQ9LNB91e-104LBD2_ARATH; LOB domain-containing protein 2
TrEMBLA0A3P6G1H41e-140A0A3P6G1H4_BRAOL; Uncharacterized protein
STRINGBo8g114670.11e-122(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM105392635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-86LOB domain-containing protein 2