PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013603519.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 372aa    MW: 42661.9 Da    PI: 6.4146
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013603519.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF71.85.9e-23953145
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    kr e++ nrqvt+skR+ gilKKA+ELS+LCd+++ +++fs+tgk
  XP_013603519.1  9 KRLESTGNRQVTYSKRKSGILKKAKELSILCDIDIVLLMFSPTGK 53
                    6889****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.1E-31160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.838161IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.58E-27295IPR002100Transcription factor, MADS-box
CDDcd002663.81E-28282No hitNo description
PRINTSPR004046.5E-19323IPR002100Transcription factor, MADS-box
PfamPF003194.0E-201257IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-192338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-193859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MGRVKLKIKR LESTGNRQVT YSKRKSGILK KAKELSILCD IDIVLLMFSP TGKPTVFHGE  60
HSCIEEVISK FAQLTPQERT KRKLESLEAL KKTFKKLDHD VNIHEFLGAR NQTIEGLSNQ  120
VAIFQAQLME CHRRLSCWTN INRIENTEHL NLLEESLRKS IERIQIHKEH YRNSQLMPIE  180
CTTTQFHSGI QLPLEMGGNS SSMQEAHPMS WLPDNDNQQT ILPGDSSFLP HREMDGSIPV  240
YSNCFFESVK QEDQICNNPG QTFEQLEQQG NGCLGLQQIG EEYSYPTSFG TSLGMEEDQE  300
KKIKSEMELN NLQQQQQQDP SSVYDPRANN GGCFQIPHDQ SMFATDHQHH HHHQNWVPDS  360
MLGQTSYSQQ PN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-13192190Myocyte-specific enhancer factor 2B
1tqe_Q1e-13192190Myocyte-specific enhancer factor 2B
1tqe_R1e-13192190Myocyte-specific enhancer factor 2B
1tqe_S1e-13192190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1431720.0AY143172.1 Arabidopsis thaliana MADS-box protein AGL65 (AGL65) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013603519.10.0PREDICTED: MADS-box transcription factor 25-like
SwissprotQ7X9I00.0AGL65_ARATH; Agamous-like MADS-box protein AGL65
TrEMBLA0A0D3DWK60.0A0A0D3DWK6_BRAOL; Uncharacterized protein
STRINGBra031049.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59332543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.10.0AGAMOUS-like 65