PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013602599.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 530aa    MW: 58711.7 Da    PI: 6.3676
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013602599.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS405.84.1e-1241535231374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+e+L+e+A+avs+gd+++a  ++  l++++s +g+p+qRl +y++e+L+arl++++ ++y+al+++e +     e ++++ +++e++P+ kf++
  XP_013602599.1 153 LKEVLVEAARAVSEGDFAAACGFIDVLEQMVSVSGTPIQRLGTYMAEGLRARLQGTGGNIYRALKCNEPT---GRELMSYMGVLYEICPYWKFAY 244
                     5789*****************************************************************9...99999999************** PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                      +aN aIleav+ge+rvHiiDf+i qG Q++ L+++La+Rp+gpp lR+Tgv++++s   +   l+ +ge+La++A++ gvpfef+  +  +  +
  XP_013602599.1 245 NAANAAILEAVAGEKRVHIIDFQIAQGSQYMFLINELAKRPGGPPLLRVTGVDDSQSRyaRGGGLSLIGEKLADMAQSRGVPFEFHD-AIMSGCK 338
                     ******************************************************999899999************************.7888999 PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++ e+L v+pg a++Vn+ + lh+++desvs+e++rd++L+l+ksl Pk+v++veqe+++n+++Fl rf+e+l+yy+a+f+s++a  pr++++ri
  XP_013602599.1 339 VHREHLGVEPGFAVVVNFPYVLHHMPDESVSVENHRDRLLHLIKSLGPKLVTLVEQESNTNTSPFLSRFVETLDYYTAMFESIDAARPRDDKQRI 433
                     99********************************************************************************************* PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + E+++++r+ivn++ace+aer+erhe l+kWr r+++aGF   p+s++aa  a+ +l+ ++++ y++ e++g+l+l Wk+rp+ ++SaW+
  XP_013602599.1 434 SAEQHCVARDIVNMIACEEAERVERHEVLGKWRVRMMMAGFMGWPVSSSAAFAASEMLKGYDKN-YKLGESEGALYLFWKRRPMATCSAWK 523
                     **************************************************************66.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.476127504IPR005202Transcription factor GRAS
PfamPF035141.4E-121153523IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MQTSQKHHSA AGLHMLYPQV HCSPQFQVID NKKGFSDTPS KESFFTLESS TASGPLPSYE  60
SPSVSITSGR SPFSPQASCI SDLHPSPENI YGSPLSGASS HVYDEAHVKN KIRELEVSLL  120
SVDPKVEEYS GFTPAGKSWN WDELLALTPQ LDLKEVLVEA ARAVSEGDFA AACGFIDVLE  180
QMVSVSGTPI QRLGTYMAEG LRARLQGTGG NIYRALKCNE PTGRELMSYM GVLYEICPYW  240
KFAYNAANAA ILEAVAGEKR VHIIDFQIAQ GSQYMFLINE LAKRPGGPPL LRVTGVDDSQ  300
SRYARGGGLS LIGEKLADMA QSRGVPFEFH DAIMSGCKVH REHLGVEPGF AVVVNFPYVL  360
HHMPDESVSV ENHRDRLLHL IKSLGPKLVT LVEQESNTNT SPFLSRFVET LDYYTAMFES  420
IDAARPRDDK QRISAEQHCV ARDIVNMIAC EEAERVERHE VLGKWRVRMM MAGFMGWPVS  480
SSAAFAASEM LKGYDKNYKL GESEGALYLF WKRRPMATCS AWKPNPNQIV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-5518652336375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: During development, higher expression levels are detected in young rosette leaves, senescing leaves and petals and sepals at flower stage 15. {ECO:0000269|PubMed:16680434}.
UniprotTISSUE SPECIFICITY: Expressed in roots, hypocotyls, cotyledons, shoot apex, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:16680434, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that acts as a positive regulator of continuous red light signals downstream of phytochrome B (phyB). Required for the regulation of hypocotyl elongation during de-etiolation. May be required to modulate phytochrome A (phyA) signal transduction in a phyB-independent way. {ECO:0000269|PubMed:16680434}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013602599.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By osmotic and cold stresses, and UV-A/B. {ECO:0000269|PubMed:16680434}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2325680.0AC232568.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH122A22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602599.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_013602605.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A0D3A7D80.0A0A0D3A7D8_BRAOL; Uncharacterized protein
STRINGBo1g052870.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13