PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013602013.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family FAR1
Protein Properties Length: 252aa    MW: 29147.6 Da    PI: 5.8165
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013602013.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR193.72.3e-2987174291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+sk ++s+++g+ + r++vC+keg+r ++k++  k  r+raetr+gC+a++ ++ke++gkw++tk+ +eHnH+l+p
  XP_013602013.1  87 FYNAYATKVGFVIRVSKLSRSRHDGSPIGRQLVCNKEGYRLPSKRD--KVIRQRAETRVGCRAMILIRKENSGKWVITKFAKEHNHPLMP 174
                     9******************************************999..999************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.0E-2787174IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MMMTISVENH NEMGESSGQA MIEQDDDENR NEIGENSNQE MPLEQDEKVD PDSIPLTVSD  60
MAEEEVQGGD EPYVGQEFES EAAAHGFYNA YATKVGFVIR VSKLSRSRHD GSPIGRQLVC  120
NKEGYRLPSK RDKVIRQRAE TRVGCRAMIL IRKENSGKWV ITKFAKEHNH PLMPGRVRRG  180
CIYDQYPNEH DKIQELMQQL AAEKKRAATY KRHLEMLFEQ IEQHNESLTK RIQHIVDNVR  240
DLDQRDHQQN QV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013602013.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0580890.0AY058089.1 Arabidopsis thaliana AT3g59470/T16L24_20 mRNA, complete cds.
GenBankAY1430810.0AY143081.1 Arabidopsis thaliana At3g59470/T16L24_20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602010.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1
RefseqXP_013602013.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 6-like isoform X1
TrEMBLA0A078JQE80.0A0A078JQE8_BRANA; BnaC08g48980D protein
STRINGBo8g093280.10.0(Brassica oleracea)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59470.21e-164FAR1 family protein