PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013601979.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 658aa    MW: 72051.7 Da    PI: 5.5571
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013601979.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.63.7e-16371409240
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+CnCkkskClk+YCeCfaag++C e C+C dC+Nk 
  XP_013601979.1 371 SCKRCNCKKSKCLKLYCECFAAGVYCIEPCSCIDCFNKP 409
                     689**********************************96 PP

2TCR52.69.2e-17456494139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     ++k+gCnCkks+ClkkYCeCf+ g+ Cs +C+Ce+CkN 
  XP_013601979.1 456 RHKRGCNCKKSNCLKKYCECFQGGVGCSINCRCEGCKNA 494
                     589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.3E-19370411IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.245371496IPR005172CRC domain
PfamPF036386.3E-12373408IPR005172CRC domain
SMARTSM011142.1E-17456497IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.9E-12458494IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 658 aa     Download sequence    Send to blast
MDTPQKSITQ IETPVSKSRV EDSPVFNYIN SLSPIRPVKS IPNPHQFSAL NFTSPPSVFT  60
SPHLTSSHKE SRFFKTHHPS PDPTIPVQES PDDSTSNEGA AAEAEVTPNF NIDASTEMEQ  120
PHIAKETNLD DLPLAVSPCG RETTGDLSLV PYASPPREEN GEDDTGMEMY GNVQGKNETP  180
DWDRLIADSS EFLIFSSPND SEAFRCLMMQ RASPSQAPSV MMPTMQPGSI NEPESSIASP  240
YGAVSVLHRG IRRRCLDFEM PGNKQTSSEN NTSACGSSSR CVVPSIGLHL NALLMSTKDC  300
KTNNTTHDYS CSEKYQVGLQ GSSSTLQETL DQTETETRDL EDVPVEPTLE ELHLSSPKKK  360
RVKLEAGEGE SCKRCNCKKS KCLKLYCECF AAGVYCIEPC SCIDCFNKPI HEDTVLATRK  420
QIESRNPLAF APKVIKSSDL VLETGDDASK TPASARHKRG CNCKKSNCLK KYCECFQGGV  480
GCSINCRCEG CKNAFGRKDG SAIVDMEAEQ EEENETSGKN RRAKTQENSE VYLMRKEESS  540
ALPATPMSVY RQQLVQLKNM MPPPQSVLGV GSSSSGMFNS QYTRKLEMKS LETVAEDGAE  600
EMPEILSHSS IDNVNAVSPN GKRVSPPHLD SSSSGRRSGG RKLILQSIPT FPSLTPQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1637549314120Protein lin-54 homolog
5fd3_B1e-1637549314120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1356363PKKKRVKL
2356364PKKKRVKLE
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at the late stage of pollen development in tricellular and mature pollen. {ECO:0000269|PubMed:18057042}.
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in all the aerial organs with highest expression in flowers. {ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013601979.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL1615397e-92AL161539.2 Arabidopsis thaliana DNA chromosome 4, contig fragment No. 39.
GenBankCP0026877e-92CP002687.1 Arabidopsis thaliana chromosome 4 sequence.
GenBankZ973377e-92Z97337.2 Arabidopsis thaliana DNA chromosome 4, ESSA I FCA contig fragment No. 2.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013601979.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
RefseqXP_013668469.10.0protein tesmin/TSO1-like CXC 2
SwissprotF4JIF50.0TCX2_ARATH; Protein tesmin/TSO1-like CXC 2
TrEMBLA0A0D3A8500.0A0A0D3A850_BRAOL; Uncharacterized protein
STRINGBo1g057470.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14672891
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.10.0TESMIN/TSO1-like CXC 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]