PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013601834.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 489aa    MW: 54377.6 Da    PI: 4.8376
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013601834.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS322.49.4e-991224882374
            GRAS   2 velLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     ve L++++++v+s++l+laq +L+rl+++ +sp+g+p+qR+a+yf+eAL + l++s  +  + l+++++     ++++ a+k fs +sPi+ fsh
  XP_013601834.1 122 VEDLIRVVDCVESDELQLAQVILSRLNQRlRSPAGRPLQRAAFYFKEALGSLLTGSNRNQTRLLSSWTE----IVQKIRAVKEFSGISPIPLFSH 212
                     688*************************99*************************55555554444444....8********************* PP

            GRAS  96 ltaNqaIleavege.....ervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakr 185
                     +taNqaIl++++++       vH++Dfdi+ G+Q+++L++++a+++ ++  lR+T+v+++e   + e++ ++e+L++fA+e++++f+++++++k+
  XP_013601834.1 213 FTANQAILDSLSSQqssssPFVHVVDFDIGFGGQYASLMREIAEKSISSGFLRVTAVVAEE--CAVETRLVKENLTQFAAEMKIRFQIEFVLMKT 305
                     ***********99867766789*************************************66..9******************************* PP

            GRAS 186 ledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerflealeyysalfdsleaklpr 277
                     +e+l+++++r+  gE ++V ++ +++r l       s + e++  ++++ Pkvvv+v++e  ++  +++sF ++f+ ale+y+++++sl+a +p+
  XP_013601834.1 306 FEMLSFKAIRFVDGERTVVLISPAIFRRL-------SGIAEFVTNLRRVFPKVVVFVDSEgwTEIaGAGSFRREFVTALEFYTMVLESLDAAAPP 393
                     ****************************9.......44567*******************766668999************************** PP

            GRAS 278 eseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSa 372
                      +  ++ vE+++l+++i  +v +    r  r+   ++Wre++  aG+++++ls++a  qa++ll+k +++g++v +++++lvl+W++r+Lv++Sa
  XP_013601834.1 394 GDLVKKIVEAFVLRPKIAAAVETTAGGR--RNVGEMTWREAFCGAGMRSIQLSQFAIFQAECLLEKAQVRGFHVAKRQEELVLCWHGRALVATSA 486
                     *********************9999884..66677************************************************************ PP

            GRAS 373 Wr 374
                     Wr
  XP_013601834.1 487 WR 488
                     *8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.35495468IPR005202Transcription factor GRAS
PfamPF035143.2E-96122488IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0048831Biological Processregulation of shoot system development
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MKVQASSPQD NQPSNTNSTD NNNNNNQIPS MDEHVMRSMD WDSIMKELEL DDDSTPNPLK  60
TEFTTTDSAI GPLYAVDSNL PGFPDQIQPS DFDSSDAYQN QTAGYGFTSL DSVDNGGGFD  120
FVEDLIRVVD CVESDELQLA QVILSRLNQR LRSPAGRPLQ RAAFYFKEAL GSLLTGSNRN  180
QTRLLSSWTE IVQKIRAVKE FSGISPIPLF SHFTANQAIL DSLSSQQSSS SPFVHVVDFD  240
IGFGGQYASL MREIAEKSIS SGFLRVTAVV AEECAVETRL VKENLTQFAA EMKIRFQIEF  300
VLMKTFEMLS FKAIRFVDGE RTVVLISPAI FRRLSGIAEF VTNLRRVFPK VVVFVDSEGW  360
TEIAGAGSFR REFVTALEFY TMVLESLDAA APPGDLVKKI VEAFVLRPKI AAAVETTAGG  420
RRNVGEMTWR EAFCGAGMRS IQLSQFAIFQ AECLLEKAQV RGFHVAKRQE ELVLCWHGRA  480
LVATSAWRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A3e-2812748724377Protein SCARECROW
5b3h_D3e-2812748724377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013601834.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013601834.10.0PREDICTED: scarecrow-like protein 15
SwissprotO232100.0SCL15_ARATH; Scarecrow-like protein 15
TrEMBLA0A0D3A1H10.0A0A0D3A1H1_BRAOL; Uncharacterized protein
TrEMBLA0A3P6F6V90.0A0A3P6F6V9_BRAOL; Uncharacterized protein
STRINGBo1g005470.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42912857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.10.0GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]