PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013600953.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 63aa    MW: 7333.76 Da    PI: 10.2301
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013600953.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF53.53.1e-171053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     ie    r+  +skR++g+lKKAeE+ vLCd ++ +++fs+t k
  XP_013600953.1 10 TIECPKERSSKYSKRKKGLLKKAEEMAVLCDSDIILLVFSPTSK 53
                    6777889999******************************9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554551.03E-19159IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.745153IPR002100Transcription factor, MADS-box
SMARTSM004323.3E-22160IPR002100Transcription factor, MADS-box
CDDcd001201.74E-19259No hitNo description
PRINTSPR004041.6E-14323IPR002100Transcription factor, MADS-box
PfamPF003194.8E-171154IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-142338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-143859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 63 aa     Download sequence    Send to blast
MGRKKIDLKT IECPKERSSK YSKRKKGLLK KAEEMAVLCD SDIILLVFSP TSKPNLFYPH  60
YRC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2373041e-84AC237304.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH006I08, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600953.11e-39PREDICTED: MADS-box transcription factor 31-like
TrEMBLA0A0D3DVC81e-38A0A0D3DVC8_BRAOL; Uncharacterized protein
STRINGAT2G26320.19e-22(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26320.13e-10AGAMOUS-like 33