PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013600358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 779aa    MW: 87112.3 Da    PI: 6.0521
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013600358.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK901.8e-28522572252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                      k+i+l++l+++F++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rkik++
  XP_013600358.1 522 DKTITLDVLRQHFAGSLKDAAKNIGVCPTTLKRICRQHGIQRWPSRKIKKV 572
                     689**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.006506592IPR003035RWP-RK domain
PfamPF020422.5E-25524572IPR003035RWP-RK domain
SuperFamilySSF542774.77E-22678773No hitNo description
SMARTSM006661.3E-25688771IPR000270PB1 domain
PROSITE profilePS5174526.62688771IPR000270PB1 domain
PfamPF005641.5E-18689770IPR000270PB1 domain
CDDcd064073.30E-39689769No hitNo description
Gene3DG3DSA:3.10.20.2401.0E-19689768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 779 aa     Download sequence    Send to blast
MEDSLLQTEN TVMDTEFMDG LLLDGCWLET TDGSVSPFDP SSFKWPPTQD TSSICTSEVV  60
SQTYGQDCAS LDEFPWNKRW WIGPGGGGSS ITERLVQAVE HIRDYTTERG SLIQLWVPVN  120
RGGKRVLTTR EQPYSHDPTC QRLANYREVS VNYHFSAEKE DSNALAGLPG RVFLGKLPEW  180
TPDVRFFRSE EYPRVHHAQD CDVRGTLAIP VFEQGSKVCL GVIEVVMTTE MVKLAPELDS  240
ICRALQAVDL RSTEVQIPPS LKGCDLSYKA ALPEIRNLLR CACETHKLPL AQTWVSCLHQ  300
SKSGCRHNDE NYIHCVSTID DACYLGDPTV REFHEACSEH HLLKGQGVVG QAFLTNGPCF  360
SPDVSNYKKS EYPLSHHANI FGLHGSVAIR LRCIHTGSVD FVLEFFLPKD CGDVEEQRKM  420
LNALSTIMAH VPRSLRIVTD KELEDESEVI VTPKIEITSE HTKDWLHQSN NPENLGLIFD  480
VGDKASDEFG LKRGFGYTRD SNINESSTFS SKMAETKRTK ADKTITLDVL RQHFAGSLKD  540
AAKNIGVCPT TLKRICRQHG IQRWPSRKIK KVGHSLQKIQ RVIDSVEGVS GLLPIGSFYA  600
NFPNLASSQE PSLQGKTSLP PQPLQLSKSP VSPYSHSSSS SQCCSSETQL NSDTTTTTDV  660
GGGVLTLSSL EKIPQSTNLS LSSLDNDFLR IKVSYGEEKI RFRMGNSRRL SDLLWEIGKR  720
FSIEDMSRCD LKYLDEDNEW VLLTCDEDVE ECVSVCSTTR SHTIKLLLHV SSHCYNSWQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013600358.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893460.0AC189346.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB042N05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013600358.10.0PREDICTED: protein NLP4-like
SwissprotQ9LE380.0NLP4_ARATH; Protein NLP4
TrEMBLA0A0D3DQL80.0A0A0D3DQL8_BRAOL; Uncharacterized protein
STRINGBo8g070310.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM34612663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20640.20.0Nin-like family protein