PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013599360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 405aa    MW: 45418.3 Da    PI: 6.0194
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013599360.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS438.16.4e-134454054374
            GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
                     +L++cA+a+s+++l laq+++ +l+ ++s +g+p+qRl ay++e+L  rla ++s++yk+l+++e +   s + l+++ l++ev+P++kf+++ a
  XP_013599360.1  45 VLVACAKAISENNLLLAQWCIGELRGMVSISGEPIQRLGAYMLEGLVVRLAATGSSIYKSLQSREPE---SYDFLSYVYLLHEVCPYFKFGYMSA 136
                     79***************************************************************99...9************************ PP

            GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlelee 193
                     N aI ea++ eer+HiiDf+i++G QW+aL+qa+a+Rp+g+p++RiTg+g+       +l ++++rL+k+A++++vpf+f++ v+ +  ++e+e+
  XP_013599360.1 137 NGAIAEAMKDEERIHIIDFQIGEGSQWVALIQAFAARPGGAPNIRITGIGD-----GSKLVAVRRRLEKLAKKFDVPFKFHA-VSASSYKVEVEN 225
                     ***************************************************.....889***********************.7999999***** PP

            GRAS 194 LrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEre 288
                     L+v+ gEal Vn++++lh+l+desvs+e++rd+vL++vkslsPkvv++veqe+++n+++Fl rfle+l+yy+a+f+s+++ lpr+++eri+vE++
  XP_013599360.1 226 LDVRIGEALGVNFAYMLHHLPDESVSTENHRDRVLRMVKSLSPKVVTLVEQECNTNTSPFLPRFLETLSYYTAMFESIDVILPRNHKERINVEQH 320
                     *********************************************************************************************** PP

            GRAS 289 llgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +l+ ++vn++acegaer+ rhe l+kW++r+++aGF p+pls+ + +++++ll+ ++ +gy +ee++g+l+lgW+dr Lvs +aW+
  XP_013599360.1 321 CLASDVVNIIACEGAERIVRHELLGKWKSRFSMAGFVPYPLSSVVSATIRSLLKDYN-NGYGIEERDGALCLGWMDRILVSSCAWK 405
                     *********************************************************.9**************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.26616386IPR005202Transcription factor GRAS
PfamPF035142.2E-13145405IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 405 aa     Download sequence    Send to blast
MLQPLPEIAE SINDSVYYEH SIWPGDTDDL MLIVDAISRG DLKWVLVACA KAISENNLLL  60
AQWCIGELRG MVSISGEPIQ RLGAYMLEGL VVRLAATGSS IYKSLQSREP ESYDFLSYVY  120
LLHEVCPYFK FGYMSANGAI AEAMKDEERI HIIDFQIGEG SQWVALIQAF AARPGGAPNI  180
RITGIGDGSK LVAVRRRLEK LAKKFDVPFK FHAVSASSYK VEVENLDVRI GEALGVNFAY  240
MLHHLPDESV STENHRDRVL RMVKSLSPKV VTLVEQECNT NTSPFLPRFL ETLSYYTAMF  300
ESIDVILPRN HKERINVEQH CLASDVVNII ACEGAERIVR HELLGKWKSR FSMAGFVPYP  360
LSSVVSATIR SLLKDYNNGY GIEERDGALC LGWMDRILVS SCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-59464058375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, cotyledons, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013599360.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013599360.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ9S7H50.0SCL21_ARATH; Scarecrow-like protein 21
TrEMBLA0A0D3D4J30.0A0A0D3D4J3_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EUR60.0A0A3P6EUR6_BRAOL; Uncharacterized protein
STRINGBo7g030310.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM62128141
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04890.10.0SCARECROW-like 21
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]