PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598804.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 550aa    MW: 61318.3 Da    PI: 4.9606
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598804.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS438.84e-1341805503374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     + L++cA+a+s+g+ e+a ++L++l++++s +gdp qR+aay++e+Laar+a s++ ly+al+++e +   s+e+laa+++++e++P++kf++l+
  XP_013598804.1 180 QILISCARALSEGKSEEALSMLNELRQIVSIQGDPSQRIAAYMVEGLAARMAASGKFLYRALKCKEPP---SDERLAAMQVLFEACPCFKFGFLA 271
                     78*****************************************************************9...9*********************** PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                     aN aI+e++  e++vHiiDfdi+qG Q+++L++++a+ p++ p+lR+Tg+++pes+  s   l+ +g rL+++A+  gv+f+f+++++k+   ++
  XP_013598804.1 272 ANGAIVESIRDEKEVHIIDFDINQGNQYMTLIRTIAELPGKGPRLRLTGIDDPESVqrSVGGLRIIGLRLEQLAKDHGVSFKFKAVASKTSLIVS 366
                     ******************************************************9989999************************988899999* PP

            GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikv 285
                     +++L +kpgEal+Vn+++qlh+++desv++ ++rde+L++vk+l+Pk+v+vveq++++n+++F+ rf+ea eyysa+f+sl+++lpr+s+er++v
  XP_013598804.1 367 PSTLGCKPGEALIVNFAFQLHHMPDESVTIVNQRDELLHMVKGLNPKLVTVVEQDVNTNTSPFFPRFMEAYEYYSAVFESLDVTLPRDSQERMNV 461
                     *********************************************************************************************** PP

            GRAS 286 ErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     Er++l+r+ivnvvaceg+er+er e ++kWr+r+++aGF++ p+s++++ ++++ll++ +   y+v+ee g+l+++W+d++L+++SaWr
  XP_013598804.1 462 ERQCLARDIVNVVACEGEERIERYEVAGKWRARMMMAGFSSRPMSSRVTRSIQSLLKEEYCSKYKVKEEMGELLFCWEDKSLIVASAWR 550
                     ************************************************************666*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.155152530IPR005202Transcription factor GRAS
PfamPF035141.4E-131180550IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MVEQTARVMS LVRSAEPSAA AYRNPKLYSP NENGYNSGGG ASVEIFDPDR SKNTCLTHDN  60
SYPSQSYFLD SPTEQHPVAC GAASVSSFGS LDSSPYQSRP VLGSSMEFDD EQMRSKIQEL  120
ERALLSDEDD DIMEGLDHLM EIDNEWSYQN HSSKDSSSAD SNSQASSTKE VVSQAKTPKQ  180
ILISCARALS EGKSEEALSM LNELRQIVSI QGDPSQRIAA YMVEGLAARM AASGKFLYRA  240
LKCKEPPSDE RLAAMQVLFE ACPCFKFGFL AANGAIVESI RDEKEVHIID FDINQGNQYM  300
TLIRTIAELP GKGPRLRLTG IDDPESVQRS VGGLRIIGLR LEQLAKDHGV SFKFKAVASK  360
TSLIVSPSTL GCKPGEALIV NFAFQLHHMP DESVTIVNQR DELLHMVKGL NPKLVTVVEQ  420
DVNTNTSPFF PRFMEAYEYY SAVFESLDVT LPRDSQERMN VERQCLARDI VNVVACEGEE  480
RIERYEVAGK WRARMMMAGF SSRPMSSRVT RSIQSLLKEE YCSKYKVKEE MGELLFCWED  540
KSLIVASAWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-571805506375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, shoots, leaves, flowers and siliques. {ECO:0000269|PubMed:10341448, ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013598804.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598804.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLA0A0D3D7H20.0A0A0D3D7H2_BRAOL; Uncharacterized protein
TrEMBLA0A3P6EUB40.0A0A3P6EUB4_BRAOL; Uncharacterized protein
STRINGBo7g059410.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69532744
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]