PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598692.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 598aa    MW: 64943.6 Da    PI: 4.4706
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598692.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3711.6e-1132275983374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                     +++++c   ++s++ e a ++L r+++ +s++gdp++R+  yfteAL +rl+   +++++  + s+++   +++ + ++k++++++P++kf+hlt
  XP_013598692.1 227 RAIYDCSLILDSSESEDAAKALVRIKKSVSEHGDPTERVGYYFTEALCNRLSP--DSVSNDSSQSQAA-AIVENLILSYKTLNDACPYFKFAHLT 318
                     67899999********************************************9..6666555444444.4599999******************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     aNqaIlea+e+++++Hi+Df+i qG+QWpaLlqaLa+R++g+p ++Ri g+ +p+s     + +l +tg+rL++fA+ l+++f+f + v + ++ 
  XP_013598692.1 319 ANQAILEATEHSSKIHIVDFGIVQGIQWPALLQALATRSSGKPaQVRISGIPAPSSLgqsPEPSLIATGNRLRDFAKVLDLNFDFIP-VLTPIHL 412
                     ***************************************77666*********9998998999************************.799**** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     l+ +++rv+p+EalaVn++lql++llde+ ++ +   + L+l +sl+P vv++ e ++++n+  F++r+ +al++ysa+f+sle +l+r+seer 
  XP_013598692.1 413 LNGSSFRVDPDEALAVNFMLQLYKLLDETPAVFD---TALRLARSLNPMVVTLGEYDVSLNRVGFANRVKNALHFYSAVFESLEPSLGRDSEERL 504
                     **************************99988887...********************************************************** PP

            GRAS 284 kvErellgreivnvvacegae.rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv.lgWkdrpLvsvSaWr 374
                      vEr+l+gr i+ ++  e +  +r r+e +e+Wr  +e+aGF++v+ls++a++qa+ ll +++ s  y++ e++  +v l W+d pL++vS+Wr
  XP_013598692.1 505 RVERVLFGRTISGLIGPEITGnQRLRMEGKEQWRVLMENAGFESVKLSNYAVSQAEILLWNYNySSLYSIVESKPGFVsLAWNDLPLLTVSSWR 598
                     ****************997764789**************************************9999*******99999**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.593199576IPR005202Transcription factor GRAS
PfamPF035145.5E-111227598IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MAYMCTDSGN LMAIAQQVIK QKQQQEQQPQ DHQIFGINPL SLNPWPTANT QSLGFGLSGS  60
GFPDPFQVNG GGDPGDSGFS FHSLEHHHPT AGGGGGGGGF RLSDFDGGTG GEFESDEWME  120
TLITGGDSVA AAEGPDCDTW QNNNDFVIYG PDPFAAYPSS QPSDLNQVVA TSTSLPSALW  180
APSSPLSAPP LPSLSPPRQK IKDPETNDSE DGGSGPHDFD LEPPLLRAIY DCSLILDSSE  240
SEDAAKALVR IKKSVSEHGD PTERVGYYFT EALCNRLSPD SVSNDSSQSQ AAAIVENLIL  300
SYKTLNDACP YFKFAHLTAN QAILEATEHS SKIHIVDFGI VQGIQWPALL QALATRSSGK  360
PAQVRISGIP APSSLGQSPE PSLIATGNRL RDFAKVLDLN FDFIPVLTPI HLLNGSSFRV  420
DPDEALAVNF MLQLYKLLDE TPAVFDTALR LARSLNPMVV TLGEYDVSLN RVGFANRVKN  480
ALHFYSAVFE SLEPSLGRDS EERLRVERVL FGRTISGLIG PEITGNQRLR MEGKEQWRVL  540
MENAGFESVK LSNYAVSQAE ILLWNYNYSS LYSIVESKPG FVSLAWNDLP LLTVSSWR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-1402245983375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in leaves, sepals, filaments of stamen, and in the central cylinder of the elongation zone in root. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013598692.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598692.10.0PREDICTED: scarecrow-like protein 4
SwissprotQ9FL030.0SCL4_ARATH; Scarecrow-like protein 4
TrEMBLA0A0D3D8D50.0A0A0D3D8D5_BRAOL; Uncharacterized protein
STRINGBo7g064520.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM47862752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66770.10.0GRAS family protein
Publications ? help Back to Top
  1. Wortman JR, et al.
    Annotation of the Arabidopsis genome.
    Plant Physiol., 2003. 132(2): p. 461-8
    [PMID:12805579]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]