PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598468.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 579aa    MW: 63150.5 Da    PI: 5.6706
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598468.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS443.41.6e-1352145741374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppset.seknsseelaalklfsevsPilkfs 94 
                     lv++L++cAeav+s++l+la+al++++  la +++ +m+++a+yf+eALa+r++r        l+p +t  +++ s++l++   f+e++P+lkf+
  XP_013598468.1 214 LVHALMACAEAVQSSNLTLAEALVKQIGFLAVSQAGAMRKVATYFAEALARRIYR--------LSPPQTqIDHSLSDTLQM--HFYETCPYLKFA 298
                     689****************************************************........444444043445555444..5*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     h+taNqaIlea+eg++rvH+iDf+++qGlQWpaL+qaLa R++gpps+R+Tg+g+p++++++ l+e+g +La++Ae+++v+fe++ +va++l+dl
  XP_013598468.1 299 HFTANQAILEAFEGKKRVHVIDFSMNQGLQWPALMQALALREGGPPSFRLTGIGPPAADNSDHLHEVGCKLAQLAEAIHVEFEYRGFVANSLADL 393
                     *********************************************************************************************** PP

            GRAS 190 eleeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseer 282
                     + ++L+++p   Ea+aVn+v++lh+ll +++ +e+    v  +v +++P +++vveqe++hn++ Fl+rf+e+l+yys+lfdsle      s+++
  XP_013598468.1 394 DASMLELRPseTEAVAVNSVFELHKLLGRPGGIEK----VFGVVTQIKPVIFTVVEQESNHNGPVFLDRFTESLHYYSTLFDSLEGA---PSSQD 481
                     ********9999*******************9999....*********************************************999...79999 PP

            GRAS 283 ikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +++++++lg++i+n+vaceg +r+erhetl++W++r++++GF p++l+++a kqa++ll+ ++ ++gyrvee++g+l+l W++rpL+++SaW+
  XP_013598468.1 482 KVMSEVYLGKQICNLVACEGPDRVERHETLSQWSNRFGSSGFVPAHLGSNAFKQASTLLALFNrGEGYRVEENNGCLMLSWHTRPLITTSAWK 574
                     ********************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120412.2E-3242109IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011291.1E-3842115No hitNo description
PROSITE profilePS5098565.579188553IPR005202Transcription factor GRAS
PfamPF035145.4E-133214574IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0042176Biological Processregulation of protein catabolic process
GO:0042538Biological Processhyperosmotic salinity response
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
MKRDLHQFQG PNHGTSIAGS STSSPAVFGK DKMMMVKEEE DDELLGVVGY KVRSSEMAEV  60
ALKLEQLETM MGNVQEDGLA HLATDTVHYN PAELYSWLDN MLTELNPPAA SGSSGLNQIL  120
PSPEVNNSFF TGGGEYDLKA IPGSAICRRS NQFPVDSSNN KRLKPCSSPD SMVTSPSPAV  180
QIGGVVGTTV TTTTASESTR PLILVDSQDN GVRLVHALMA CAEAVQSSNL TLAEALVKQI  240
GFLAVSQAGA MRKVATYFAE ALARRIYRLS PPQTQIDHSL SDTLQMHFYE TCPYLKFAHF  300
TANQAILEAF EGKKRVHVID FSMNQGLQWP ALMQALALRE GGPPSFRLTG IGPPAADNSD  360
HLHEVGCKLA QLAEAIHVEF EYRGFVANSL ADLDASMLEL RPSETEAVAV NSVFELHKLL  420
GRPGGIEKVF GVVTQIKPVI FTVVEQESNH NGPVFLDRFT ESLHYYSTLF DSLEGAPSSQ  480
DKVMSEVYLG KQICNLVACE GPDRVERHET LSQWSNRFGS SGFVPAHLGS NAFKQASTLL  540
ALFNRGEGYR VEENNGCLML SWHTRPLITT SAWKLSAVH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3h_A1e-6122157325377Protein SCARECROW
5b3h_D1e-6122157325377Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. {ECO:0000269|PubMed:15734906}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00611ChIP-seqTransfer from AT2G01570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013598468.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY9285490.0AY928549.1 Brassica rapa DELLA protein (RGA1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598468.10.0PREDICTED: DELLA protein RGA1
SwissprotQ5BN230.0RGA1_BRACM; DELLA protein RGA1
TrEMBLA0A0D3DA460.0A0A0D3DA46_BRAOL; Uncharacterized protein
STRINGBo7g078550.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM83728121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.10.0GRAS family protein