PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013598180.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family WRKY
Protein Properties Length: 512aa    MW: 56118.4 Da    PI: 5.0957
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013598180.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY80.41.9e-25238294259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYYrCt+++C++kk +e+s++ +++vei+ +g H he
  XP_013598180.1 238 RDGYNWRKYGQKQVKSPKGSRSYYRCTYSDCCAKK-IECSNDSGNMVEIVTKGLHSHE 294
                     6********************************98.*********************8 PP

2WRKY97.11.2e-30398455259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e++  +++ v+itY+geHnh+
  XP_013598180.1 398 SDGYRWRKYGQKMVKGNPNPRNYYRCTSAGCPVRKHIETAVGNTRDVVITYKGEHNHD 455
                     7********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-20234296IPR003657WRKY domain
SuperFamilySSF1182906.15E-20235296IPR003657WRKY domain
SMARTSM007742.7E-23237295IPR003657WRKY domain
PROSITE profilePS5081116.685239296IPR003657WRKY domain
PfamPF031064.4E-17239293IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.6E-31382457IPR003657WRKY domain
SuperFamilySSF1182901.44E-26391457IPR003657WRKY domain
PROSITE profilePS5081133.602392457IPR003657WRKY domain
SMARTSM007742.2E-34397456IPR003657WRKY domain
PfamPF031063.6E-23399455IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 512 aa     Download sequence    Send to blast
MEKSTQETVK NEKVKPEKEL RDGLSQLRDE ESLGTIGDDM EDVHDEAIRE VLAKDQVEDV  60
RENSPVEPND QDVIEVKETD CGKENVASEV VPVDEVAVEN REVEPSPTLN ASSDSSMVET  120
SLPSDPSASQ SQGLLLEQKS DSQVVNNLSV SPPVLRTDSD KEDIVSVVAP VDEVAVENLE  180
VKTCPALTPS SDPSMVEPSL PSDPLAAKSQ DQSLLQKSYD SRVVMNLSVS PALRTPPRDG  240
YNWRKYGQKQ VKSPKGSRSY YRCTYSDCCA KKIECSNDSG NMVEIVTKGL HSHEPPRKSS  300
FSPREIRAAS AVTPVLEVDT VVATVPSVSA TPPPTKENIC QSPTTVERKR TCENEAVEEP  360
EPKRRLKNDN TQSSDSVSKP GKKHKLVVHA ASDVGISSDG YRWRKYGQKM VKGNPNPRNY  420
YRCTSAGCPV RKHIETAVGN TRDVVITYKG EHNHDTPVPK KRHDTPSSVL LSPTSMRTRL  480
EVQVNIPSSS SQCSVGRESE KQSSEALDVV GS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A6e-25385457274WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM5931560.0KM593156.1 Brassica oleracea var. capitata WRKY transcription factor (WRKY82) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013598180.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
RefseqXP_013707515.10.0PREDICTED: probable WRKY transcription factor 32 isoform X1
SwissprotP595831e-177WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A0D3DH360.0A0A0D3DH36_BRAOL; Uncharacterized protein (Fragment)
STRINGBra024035.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63382844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-165WRKY DNA-binding protein 32