PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597142.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 235aa    MW: 26565.8 Da    PI: 9.2076
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597142.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF602.9e-194387246
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                     ien++ r+ tf kR+ gi+KKA ELS+LCd+ +avi+ s+ + +
  XP_013597142.1 43 YIENETSRKATFRKRKGGIMKKALELSTLCDVPIAVIVQSEYNSV 87
                    59**************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.4E-253493IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.7E-2434119IPR002100Transcription factor, MADS-box
PROSITE profilePS5006620.8013494IPR002100Transcription factor, MADS-box
CDDcd002667.86E-2435119No hitNo description
PRINTSPR004045.0E-143656IPR002100Transcription factor, MADS-box
PfamPF003195.3E-184486IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-145671IPR002100Transcription factor, MADS-box
PRINTSPR004045.0E-147192IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MILVYVDICM CGCVYKEHYP TLKFIRNKHK KRVMTRNRVK MAYIENETSR KATFRKRKGG  60
IMKKALELST LCDVPIAVIV QSEYNSVPEV FPPSRQAMGN VVARWDSLPL VDKTKKMMNQ  120
EQFIQQRITK ATESCKKVAK ENKELAMKEV MYDCLRGDTA PCDLGEGELR DLGGVIDQYI  180
KGLNRRIQVL MRDHASSSTS VVPDADVATS VAMPTAEMGS SSNVKDFDLN QTQSE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597142.11e-178PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A078CUU21e-149A0A078CUU2_BRANA; BnaC07g28640D protein
TrEMBLA0A0D3DCK81e-149A0A0D3DCK8_BRAOL; Uncharacterized protein
STRINGBra009913.1-P1e-129(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26630.12e-59M-type_MADS family protein