PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013597030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family B3
Protein Properties Length: 517aa    MW: 57944.9 Da    PI: 6.7009
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013597030.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B341.22.9e-13221001297
                     HTT-EE--HHH.HTT..---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
              B3  12 ksgrlvlpkkfaeeh..ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97 
                     ++++ ++p +f+++h  g +  +s++l+l++  s r+Wev+l  ++++    +++GWk+F + + +++ D++ F+ dg++ f  +v+ f
  XP_013597030.1  22 QNSNPMIPDSFVSNHlkG-N-IQSTKLKLTSdASDRTWEVEL--DGQR----FARGWKHFSDHHCVRSDDVLSFRQDGDMVF--HVTPF 100
                     455689*********844.3.48889999987899*******..8888....9**********************8888887..76655 PP

2B365.95.8e-21183273799
                     .-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
              B3   7 psdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                     ++++l+++ ++lp kfa+++g+++++  ++ l++e+g+sW++ l++ k+ g+ + ++GW +F+kang+k+  f  Fk+++ +++++v++++ +
  XP_013597030.1 183 TPSSLNRNHMYLPSKFARANGLNNRQ-CEIDLRNEHGKSWTLDLTHHKSTGQAFVRNGWTSFCKANGIKAESFRRFKFVQ-TGTKPVLQLCPN 273
                     556666677***********999766.5*************************************************998.888899999975 PP

3B337.44.4e-12301391699
                     ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTE..EEE-TTHHHHHHHHT--.TT-EEEEEE-SSSEE..EEEEE CS
              B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgr..yvltkGWkeFvkangLk.egDfvvFkldgrsefelvvkvf 97 
                     ++++++ksgr+++p +f +++g+++++  ++t+ +++g +W++ l   + +gr  ++++ G ++   ang+k  gD+++++ ++  + ++ +k++
  XP_013597030.1 301 LKPYMFKSGRVRVPASFGRANGINEAG--KITIVNKDGIEWKLHL--GNMKGRelFYIR-GLRNCFVANGIKkIGDSFTLEAIR-GGPNPILKIC 389
                     689*******************99877..69999***********..444444446666.***********999*******997.78889****9 PP

                     -S CS
              B3  98 rk 99 
                     +k
  XP_013597030.1 390 SK 391
                     97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-147101IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.08E-129102IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.85611103IPR003340B3 DNA binding domain
SMARTSM010191.1E-1214103IPR003340B3 DNA binding domain
PfamPF023622.9E-72395IPR003340B3 DNA binding domain
CDDcd100172.16E-1027100No hitNo description
Gene3DG3DSA:2.40.330.107.8E-21170273IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.59E-19173275IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.3E-26177274IPR003340B3 DNA binding domain
PROSITE profilePS5086313.662177273IPR003340B3 DNA binding domain
PfamPF023626.3E-20182273IPR003340B3 DNA binding domain
CDDcd100171.23E-18183272No hitNo description
Gene3DG3DSA:2.40.330.102.1E-7292390IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.73E-7294391IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.4E-13296392IPR003340B3 DNA binding domain
PROSITE profilePS508638.656296392IPR003340B3 DNA binding domain
PfamPF023625.8E-12300391IPR003340B3 DNA binding domain
CDDcd100175.23E-8301390No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 517 aa     Download sequence    Send to blast
MVDPVMASST KKPIFILDLS GQNSNPMIPD SFVSNHLKGN IQSTKLKLTS DASDRTWEVE  60
LDGQRFARGW KHFSDHHCVR SDDVLSFRQD GDMVFHVTPF GRRFTQQIQF ISSTSEASDD  120
DDEHNIFDDD VYDDEDIGDE DVGYDDDATS EEELYPNKTL SKKRARTETE CSSENTYLVA  180
HATPSSLNRN HMYLPSKFAR ANGLNNRQCE IDLRNEHGKS WTLDLTHHKS TGQAFVRNGW  240
TSFCKANGIK AESFRRFKFV QTGTKPVLQL CPNTEGDDEI EAEDCSEPAS MNQNKIVALE  300
LKPYMFKSGR VRVPASFGRA NGINEAGKIT IVNKDGIEWK LHLGNMKGRE LFYIRGLRNC  360
FVANGIKKIG DSFTLEAIRG GPNPILKICS KEASCDGYKT PQPRMIQASR DEEEKETKVQ  420
KKARVSAVGG PSHRTRASNR SSAGPSNLQP KQPPQPCSTS DQVAKVKQSV VDALTDVRQF  480
RSELEVKERN LEAALLEIDV LGEKIMGISK LFNINQV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013597030.10.0PREDICTED: putative B3 domain-containing protein REM4
SwissprotQ9SB790.0REM4_ARATH; Putative B3 domain-containing protein REM4
TrEMBLA0A078C5X60.0A0A078C5X6_BRANA; BnaC07g43390D protein
STRINGBra011288.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96581537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31630.10.0B3 family protein