PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596955.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 285aa    MW: 31948 Da    PI: 4.6149
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596955.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF28.32.2e-091953539
                    SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
          SRF-TF  5 nksnrqvtfskRrngilKKAeELSvLCdaevavii 39
                        r +tfskR  g+  KA+ L+ L +a+va++ 
  XP_013596955.1 19 KREYRATTFSKRCSGLYSKASQLCLLSGAQVAILA 53
                    566799**************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-5670IPR002100Transcription factor, MADS-box
CDDcd002667.75E-19787No hitNo description
PROSITE profilePS5006611.802752IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-12981IPR002100Transcription factor, MADS-box
PfamPF003192.0E-101657IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MVKRGGTKRK IDKMEKIPKR EYRATTFSKR CSGLYSKASQ LCLLSGAQVA ILATPPSSQS  60
NVSFFSFGHS SVDAVVKAYL TGRRLPPVRE EPMEEDIGVC LARKELGLEL WWEKESLSKS  120
KNRQELMDAI NSMERMLSKL RSGDLVSNYK QREEDLKNNE VTKTDVVLHK ETQEPDKTLD  180
LQAVCCILDD DLAVGFDKVT EEQDQILAIC DSFCAEENNS NINGSSVSLD RSDQAMDHLM  240
DIDGLLDLET TYESSAFDYG VLDSTRELHE TAGSLLINFE AARDL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596955.10.0PREDICTED: agamous-like MADS-box protein AGL97
TrEMBLA0A0D3DC520.0A0A0D3DC52_BRAOL; Uncharacterized protein
STRINGBra037434.1-P1e-157(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45417145
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49420.12e-60M-type_MADS family protein