PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596905.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 375aa    MW: 42746.1 Da    PI: 5.1066
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596905.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF43.34.7e-141148340
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviif 40
                    i +k+ r +tf kR+ gi+KK +EL +LC++e++ +++
  XP_013596905.1 11 IPDKTSRRTTFKKRKGGIMKKLNELVTLCGVEACAVVY 48
                    7899*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.8E-16161IPR002100Transcription factor, MADS-box
PROSITE profilePS5006616.512161IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.59E-21396IPR002100Transcription factor, MADS-box
CDDcd002661.58E-29384No hitNo description
PRINTSPR004042.9E-8323IPR002100Transcription factor, MADS-box
PfamPF003192.6E-151152IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-82338IPR002100Transcription factor, MADS-box
PRINTSPR004042.9E-83859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MVRSRVKLSL IPDKTSRRTT FKKRKGGIMK KLNELVTLCG VEACAVVYNG PNDANPEAWP  60
SREGAEEVIS KFMGFPKVER EKKMYDQDRY TGERIMKEQA TLERVKDENR ELELKEIMFD  120
LLKGKRMMEH HSSDARVVNE LCEFIDYNVS ELTKRIHLLQ ANGGPVSFPP LDVGAAVGDV  180
NPIADADVSP VTMPYGFNFD NIQNMNMNQP APAYLNGHIQ NMNMNQQAPA YLNDHIPYQN  240
MNQQALFHNQ VPTNFSGHVP YQNMMNYQEP IQNQVPDNVY DQNQNGFNGL NQGMGLDMNH  300
NLSESFNQYT NLHDQPYLNQ LMAQTQQMSY AEELASLAAM DNNNYQLPST SYMPSMDLSA  360
LNTNNNPWPT RFGLE
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013596905.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596905.10.0PREDICTED: MADS-box transcription factor PHERES 2
TrEMBLA0A0D3DCL10.0A0A0D3DCL1_BRAOL; Uncharacterized protein
TrEMBLA0A3P6F4430.0A0A3P6F443_BRAOL; Uncharacterized protein
STRINGBo7g095120.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65300.11e-43AGAMOUS-like 38