PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596673.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 578aa    MW: 61329.7 Da    PI: 8.254
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596673.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.81.2e-14123162141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  XP_013596673.1 123 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 162
                     589**************************.********986 PP

2TCR512.8e-16208246139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN 
  XP_013596673.1 208 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCLDCKNF 246
                     589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-16123163IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.136124248IPR005172CRC domain
PfamPF036387.2E-11125160IPR005172CRC domain
SMARTSM011145.3E-19208249IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12211246IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MGEEGGGGGG GGGGFPPKKE GVTDESGFPA KTPARQLDFT GGSAEHSLSP TVVATAVKTI  60
VTSSVSSSPI TTMASRLHPV VRPTVTNPPS QSPILNAPIR HPKPESPISR PRPIVEGRDG  120
TPQKKKQCNC KHSRCLKLYC ECFASGTYCD GCNCVNCFNN VDNEPARRDA VEATLERNPN  180
AFRPKIASSP HGVRDKREEI GEVVLLGKHN KGCHCKKSGC LKKYCECFQA NILCSENCRC  240
LDCKNFDGSE ERQALFHGEH ANNMAYLQQA ANAAITGAVG SSGFAPSPAP KRRKGQDISF  300
NQATKDSSSH RLGQFQQANN GRSSGPTSGT SPATVSRPGG TSSAAPSKFV YRSLLADIIQ  360
PQDVKALCSV LVAVAGEAAK TLTDKRNETE TCLASSAQDN SQGNKDVEMV AADGNQADKS  420
EPEGSNSDAS KGKPLSPATL ALMCDEQDTI FMVGAAEPNG SVDPGGCGTN SQEKSEIYAE  480
KERVVLTKFR DCLSRLISYA EIKESKCSYL ARRHIQPPPT ASATVKTENG IQQIPQPPTT  540
AQPTLTKPQP LQPTTTTNTS TTQHPHKPPA LPEKKDSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-3112525711132Protein lin-54 homolog
5fd3_B6e-3112525711132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013596673.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186580.0AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059310.0BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596673.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D3A3M40.0A0A0D3A3M4_BRAOL; Uncharacterized protein
STRINGBo1g016960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein