PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596271.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 524aa    MW: 56570.6 Da    PI: 8.3055
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596271.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.38.5e-15104143141
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ +
  XP_013596271.1 104 QKKKHCNCKHSRCLKLYCECFASGTYCDG-CNCVNCFNNVD 143
                     589**************************.********986 PP

2TCR51.32.3e-16186224139
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                     k++kgCnCkks ClkkYCeCf+a+  Cse+CkC dCkN 
  XP_013596271.1 186 KHNKGCNCKKSGCLKKYCECFQANILCSENCKCLDCKNF 224
                     589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.5E-17104144IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.058105226IPR005172CRC domain
PfamPF036385.5E-11106141IPR005172CRC domain
SMARTSM011147.5E-19186227IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.9E-13189224IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MGNAGGGGKL PPKNDGGFGV PARDPATQLD LTGGSDQHSL SKPAPTVVSP AAVTSSVPSP  60
VTVTTSRLHP VATSQSQILN APVRLPKQES PKSRPRPIVD GTPQKKKHCN CKHSRCLKLY  120
CECFASGTYC DGCNCVNCFN NVDNEPSRRD AVEATLERNP NAFRPKIASS PHGVRDKREE  180
MVLLGKHNKG CNCKKSGCLK KYCECFQANI LCSENCKCLD CKNFDGSEER RALFHGELAN  240
NMAYLQQAAN AAITGAVGSS GFAPYPAPKR RKGGQDISFN QATTDTSPAT GPSKFVYRSL  300
LADVIQPQDV KALCSVLVAV AGEAAKALTD KRNDNRVEDQ TETSLASSAQ ENSQGDVEMA  360
EPDGNQADKS RRKPLSPSTL ALMCDDEQDT IFMVAASEPN GSVDPSWCRT NSQGQSQDYA  420
ELERVVLTKL RDCLSRLISY AELKESKRSY LARRHIQSPP SATETVKMEN GIQQAPPIVN  480
GATTQPTVNK PQLLQPMQTT TNTSSTHHPH KPPALPEKKD PLNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A9e-3310623511132Protein lin-54 homolog
5fd3_B9e-3310623511132Protein lin-54 homolog
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Ubiquitous but expressed mostly in flowers. {ECO:0000269|PubMed:18057042}.
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013596271.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1186581e-167AK118658.1 Arabidopsis thaliana At4g29000 mRNA for putative transcription factor, complete cds, clone: RAFL19-93-A20.
GenBankBT0059311e-167BT005931.1 Arabidopsis thaliana At4g29000 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596271.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
RefseqXP_013705473.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D3DGP70.0A0A0D3DGP7_BRAOL; Uncharacterized protein
STRINGBo7g113450.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein