PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596023.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family SBP
Protein Properties Length: 176aa    MW: 20507 Da    PI: 9.8241
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596023.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.13.8e-4161136277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv++C+a+l+eak+y+rrhkvCevh+ka++++vsg +qrfCqqCsrfhel efDe+krsCr rLa+hnerrrk +
  XP_013596023.1  61 CQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAKRSCRMRLAGHNERRRKVS 136
                     *************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114130.64158135IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.1E-3258122IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-3759139IPR004333Transcription factor, SBP-box
PfamPF031104.6E-3161134IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MEKSQRWSYV KDKAIISNLA EQEWENSMDG EEEDAGDEDK RKRVTERARD TNTDLVPPRL  60
CQVHRCTANL TEAKQYYRRH KVCEVHAKAS AATVSGAKQR FCQQCSRFHE LPEFDEAKRS  120
CRMRLAGHNE RRRKVSGDSF GERSGRRGFR GQLIQTQERN NVDMKLPMAN TSFKRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-3859134984squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0037141e-158BT003714.1 Arabidopsis thaliana At3g15270 mRNA, complete cds.
GenBankAK1186111e-158AK118611.1 Arabidopsis thaliana At3g15270 mRNA for squamosa promoter binding protein-like 5, putative, complete cds, clone: RAFL19-86-N19.
GenBankAJ2429601e-158AJ242960.1 Arabidopsis thaliana mRNA for Squamosa promoter binding protein-like 5, (SPL5 gene).
GenBankAJ0116101e-158AJ011610.1 Arabidopsis thaliana (ecotype Landsberg erecta) mRNA for squamosa promoter binding protein-like 5.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596023.11e-131PREDICTED: squamosa promoter-binding-like protein 5
SwissprotQ9S7583e-93SPL5_ARATH; Squamosa promoter-binding-like protein 5
TrEMBLA0A0D3ADH61e-131A0A0D3ADH6_BRAOL; Uncharacterized protein
STRINGBra021094.1-P1e-123(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM86828118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.18e-82squamosa promoter binding protein-like 5