PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594287.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 117aa    MW: 13642.9 Da    PI: 10.0634
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594287.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF529.3e-17957151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+ien   rqvtfsk rn ++KKA+ELS LC+++  vi+fsst ++y +s+
  XP_013594287.1  9 KKIENVNSRQVTFSKSRNRLIKKANELSFLCEVD--VIVFSSTVNVYYFSK 57
                    68*****************************766..699********9985 PP

2SRF-TF32.31.3e-1057881851
                    HHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF 18 ngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    +g++KKA+ELS LC+++  vi+fsst k+y +ss
  XP_013594287.1 57 KGLIKKANELSFLCEVD--VIVFSSTVKVYYFSS 88
                    79************766..699********9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006621.208156IPR002100Transcription factor, MADS-box
SMARTSM004322.3E-20158IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-18155IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-13323IPR002100Transcription factor, MADS-box
PfamPF003193.1E-161055IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-132338IPR002100Transcription factor, MADS-box
PfamPF003192.0E-85786IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-85790IPR002100Transcription factor, MADS-box
PROSITE profilePS500669.5735890IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MGRGKIEMKK IENVNSRQVT FSKSRNRLIK KANELSFLCE VDVIVFSSTV NVYYFSKGLI  60
KKANELSFLC EVDVIVFSST VKVYYFSSGR EETRVVFPLR ATFYVVSAYF YLLKRFE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594287.12e-78PREDICTED: MADS-box transcription factor 23-like
TrEMBLA0A0D3D2A81e-57A0A0D3D2A8_BRAOL; Uncharacterized protein
STRINGBra005545.1-P1e-29(Brassica rapa)
STRINGBra040348.1-P2e-27(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57390.15e-22AGAMOUS-like 18