PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 201aa    MW: 23791.6 Da    PI: 8.8832
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594283.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.91.3e-181157349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    i +  +r++ f+kR+ g+lKKA+EL +LCd++  +i fs++gkl+ +
  XP_013594283.1 11 IVDRQQRNIAFAKRKSGLLKKAYELFILCDVQMVLIFFSPSGKLFMF 57
                    678899**************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.165161IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-23160IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.8E-23283IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-181057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MGRVKIQMRK IVDRQQRNIA FAKRKSGLLK KAYELFILCD VQMVLIFFSP SGKLFMFDTK  60
TRMEETIKKY VDVPIRPRLQ VQEEAFIRRW IDIMRIESQY PESIVRPREN FGDGILSQAR  120
SKEIEDEIFK CKAEMAKVEQ QYFLKHPNQW ATRDDIEYQE KILEETLDKV RSRKKCLEAQ  180
NEAFDASNCL LQTDVEISPS G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A6e-16272170Myocyte-specific enhancer factor 2A
3kov_B6e-16272170Myocyte-specific enhancer factor 2A
3kov_I6e-16272170Myocyte-specific enhancer factor 2A
3kov_J6e-16272170Myocyte-specific enhancer factor 2A
3p57_A6e-16272170Myocyte-specific enhancer factor 2A
3p57_B6e-16272170Myocyte-specific enhancer factor 2A
3p57_C6e-16272170Myocyte-specific enhancer factor 2A
3p57_D6e-16272170Myocyte-specific enhancer factor 2A
3p57_I6e-16272170Myocyte-specific enhancer factor 2A
3p57_J6e-16272170Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594283.11e-147PREDICTED: truncated transcription factor CAULIFLOWER D-like isoform X2
TrEMBLA0A078BWX21e-143A0A078BWX2_BRANA; BnaC01g01480D protein
STRINGBra011763.1-P1e-112(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.24e-26AGAMOUS-like 67