PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594279.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 203aa    MW: 23961.8 Da    PI: 8.8832
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594279.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.91.3e-181157349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                    i +  +r++ f+kR+ g+lKKA+EL +LCd++  +i fs++gkl+ +
  XP_013594279.1 11 IVDRQQRNIAFAKRKSGLLKKAYELFILCDVQMVLIFFSPSGKLFMF 57
                    678899**************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.165161IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-23160IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-23283IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-18323IPR002100Transcription factor, MADS-box
PfamPF003193.4E-181057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-182338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-183859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MGRVKIQMRK IVDRQQRNIA FAKRKSGLLK KAYELFILCD VQMVLIFFSP SGKLFMFDTK  60
TRMEETIKKY VDVPIRPRLQ VQEEAFIRRW IDIMRIESQY PESIVRPREN FGDGILSQAR  120
SKEIEDEIFK CKAEMAKVEQ QLGYFLKHPN QWATRDDIEY QEKILEETLD KVRSRKKCLE  180
AQNEAFDASN CLLQTDVEIS PSG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A7e-16272170Myocyte-specific enhancer factor 2A
3kov_B7e-16272170Myocyte-specific enhancer factor 2A
3kov_I7e-16272170Myocyte-specific enhancer factor 2A
3kov_J7e-16272170Myocyte-specific enhancer factor 2A
3p57_A7e-16272170Myocyte-specific enhancer factor 2A
3p57_B7e-16272170Myocyte-specific enhancer factor 2A
3p57_C7e-16272170Myocyte-specific enhancer factor 2A
3p57_D7e-16272170Myocyte-specific enhancer factor 2A
3p57_I7e-16272170Myocyte-specific enhancer factor 2A
3p57_J7e-16272170Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594279.11e-149PREDICTED: floral homeotic protein APETALA 1-like isoform X1
TrEMBLA0A078BWX21e-147A0A078BWX2_BRANA; BnaC01g01480D protein
STRINGBra011763.1-P1e-115(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17254910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77950.24e-28AGAMOUS-like 67