PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013594069.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family M-type_MADS
Protein Properties Length: 382aa    MW: 43245.9 Da    PI: 6.7938
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013594069.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF64.98.5e-211053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                    + en+  rq tf+kR+ngilKKA+ELSvLCd++  +++fs+tgk
  XP_013594069.1 10 KLENTAGRQATFAKRKNGILKKASELSVLCDIDLVLLMFSPTGK 53
                    679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.039153IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-28160IPR002100Transcription factor, MADS-box
CDDcd002661.71E-25281No hitNo description
SuperFamilySSF554551.29E-24292IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-17323IPR002100Transcription factor, MADS-box
PfamPF003199.4E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.4E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGRVKLKIKK LENTAGRQAT FAKRKNGILK KASELSVLCD IDLVLLMFSP TGKPSLCCAQ  60
RSIEKVIAKF SQVTPEERAK RKIEGLEVLK KTFQKLDHHV NIRDFIFSSN PTTEDLSARA  120
RILQDRISEI HGRLRYWTEP DKINNVEDLG QLEISIRQSL DQLRAHKEHF GQQQHAMQIE  180
NANFVKDWST SLLQDGIQIP LEQQLQSMPW ILNTNTTNIV TEEHNSIPQR EVECSASSSF  240
GSYPGYFGTG KSPEITISGQ DTSFLDDLTN GHLKPQTITQ QQFTENSVIP YIPSLQNDLN  300
HHQTLPLPLP HPPPVFNFPM NQREYHMNGF FEAPPPGSSV YNNTANQARF GSNSSSLPCS  360
ISMLDEYLFS QIQQEEVVLQ SS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013594069.10.0PREDICTED: MADS-box transcription factor 50 isoform X2
SwissprotQ1PFA40.0AGL30_ARATH; Agamous-like MADS-box protein AGL30
TrEMBLA0A0D3DAI10.0A0A0D3DAI1_BRAOL; Uncharacterized protein
STRINGBra024792.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03060.20.0AGAMOUS-like 30