PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593964.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GeBP
Protein Properties Length: 474aa    MW: 54849.3 Da    PI: 9.6195
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593964.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57373.63.5e-2346132397
          DUF573   3 fqrlwseeDeivlLqGlidfkaktgkspsddidafyefvk.ksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiW 96 
                     ++r+w+eeDe+++L+Gl+d++a++g +p +++ +fy+f+  +si  k+sk+q+++Kir+LK K    ++k          +++++++f lsk+iW
  XP_013593964.1  46 SSRIWNEEDELTVLKGLVDYQAQKGIEPRSNWADFYRFLGgGSITGKFSKEQVLSKIRKLKAKLIASMQK---------GNTSQSEAFLLSKRIW 131
                     78************************************96369***************************.........4556678999999999 PP

          DUF573  97 g 97 
                     g
  XP_013593964.1 132 G 132
                     7 PP

2DUF57377.81.8e-24264355697
          DUF573   6 lwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                     +w+ +D +++L+G++++++++g  + +d+d fy + k+ i++ +sk+ql+e +++LK +f+  ++++k+gk++sf+++ +++ f ls +iW 
  XP_013593964.1 264 IWNMNDVLLILKGIVEYENERGFRYNSDWDIFYGYTKDLINIPFSKKQLMEEVKKLKMRFNFYSQRSKDGKQFSFTNSYEKELFRLSTIIWA 355
                     8******************************************************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.2E-1747132IPR007592Protein of unknown function DUF573
PfamPF045041.2E-17264354IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MVNLDLPDRT SPPSHILRSR KSKSPGKHAS KPSPPEPEHV TKKNSSSRIW NEEDELTVLK  60
GLVDYQAQKG IEPRSNWADF YRFLGGGSIT GKFSKEQVLS KIRKLKAKLI ASMQKGNTSQ  120
SEAFLLSKRI WGLQNESDQS ANHTKSAEEM ANHEPSNNEV TKADNDESSS AVRDAFETMV  180
SKGLSDYQKK LQLEKLMNLG SGKRKELSDE WNELCAEEVK LNIKRLKFSA MLAEAAKWKH  240
EDDENVSYTE AIVRRRKQQK KYLIWNMNDV LLILKGIVEY ENERGFRYNS DWDIFYGYTK  300
DLINIPFSKK QLMEEVKKLK MRFNFYSQRS KDGKQFSFTN SYEKELFRLS TIIWAKNETE  360
DTFSENRQDQ AKVLVLNKDV PLVKQKRVND TRMDKDKSEE LGVMDEFDAL QDALEASTSF  420
QILGKTQQKM LFQNLKTLGA QRRKELAGEW KSLLNEEMEL HMKKLTFFAQ LSCA
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.46640.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593964.10.0PREDICTED: uncharacterized protein LOC106302008 isoform X1
TrEMBLA0A0D3D5U00.0A0A0D3D5U0_BRAOL; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61171741
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00270.12e-52DNA-binding storekeeper protein-related transcriptional regulator