PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593826.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family GRAS
Protein Properties Length: 493aa    MW: 54359.8 Da    PI: 5.695
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593826.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS311.42e-951284922374
            GRAS   2 velLlecAeavssgdlelaqalLarlsel.aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     +e L++++++v+s++l+ a+ +L+rl+++ +sp+g+p+ R+a+yf+eAL + l++     ++  + + ts+++ +e++ a k fs +sPi+ fsh
  XP_013593826.1 128 IEDLIRVVDCVDSDELQHAHVILSRLNQRlRSPAGRPLLRAAFYFKEALGSLLSG-----SNRNQNRLTSWTEIVERIRAIKEFSGISPIPLFSH 217
                     689*************************99*************************.....7788899999999********************** PP

            GRAS  96 ltaNqaIleavege..ervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrle 187
                     +taNqaIl++++++     Hi+Df+i+ G+Q+++L++++a++++ +   lR+T+v+++e  s+ e++ ++e+L +fA+ l+++f++++++++++e
  XP_013593826.1 218 FTANQAILDSLHQSssPFAHIVDFEIGFGGQYASLMREIADKSSATGgFLRVTAVVPEE--SAVETRLVKENLVQFAADLKIRFQIDFVLMRTFE 310
                     *************966678***********************966655*********66..99******************************** PP

            GRAS 188 dleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe..adh.nsesFlerflealeyysalfdsleaklpres 279
                     +l+++++r+ +gE ++V ++  ++r l       + ++++++ ++++sP+vvv+v++e      +++sF ++f++ +e+y+++++sl+a +p+ +
  XP_013593826.1 311 MLSFKAIRFVEGERTVVLISPVIFRRL-------NGISSFVNDLRRVSPNVVVFVDSEgwNGIsGAGSFQREFVSGFEFYTMVLESLDAAAPSGD 398
                     **************************9.......33557*******************642235889**************************** PP

            GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                       ++ +E ++l+++i  +v ++  + + +    ++Wre++ +aG++ vpls+++  qa++l++k +++g++v +++g+lvl+W++rpLv++SaWr
  XP_013593826.1 399 LVKKIIEGFVLRPKIAAAVEAAAVN-KRQGGGEMTWREAFCAAGMRMVPLSQFVDFQAECLVEKAQVRGFHVAKRQGELVLCWHGRPLVATSAWR 492
                     *********************9999.55556689************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098539.019101472IPR005202Transcription factor GRAS
PfamPF035146.8E-93128492IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MRVPASSNSN SGGKNLVVYD EPTSVLGLRR SPTPTTVEEK PLVSAASGGD NQFPSDDHAM  60
RSMDWDSIMR ELELDDDSTP NLKPNFPPPA HFAVVDPPLP VFPDQLNPAE YGYDSNSNNG  120
GGGGFDIIED LIRVVDCVDS DELQHAHVIL SRLNQRLRSP AGRPLLRAAF YFKEALGSLL  180
SGSNRNQNRL TSWTEIVERI RAIKEFSGIS PIPLFSHFTA NQAILDSLHQ SSSPFAHIVD  240
FEIGFGGQYA SLMREIADKS SATGGFLRVT AVVPEESAVE TRLVKENLVQ FAADLKIRFQ  300
IDFVLMRTFE MLSFKAIRFV EGERTVVLIS PVIFRRLNGI SSFVNDLRRV SPNVVVFVDS  360
EGWNGISGAG SFQREFVSGF EFYTMVLESL DAAAPSGDLV KKIIEGFVLR PKIAAAVEAA  420
AVNKRQGGGE MTWREAFCAA GMRMVPLSQF VDFQAECLVE KAQVRGFHVA KRQGELVLCW  480
HGRPLVATSA WRF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A4e-2213349125378Protein SCARECROW
5b3h_A3e-2213349124377Protein SCARECROW
5b3h_D3e-2213349124377Protein SCARECROW
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in seedlings, roots, leaves and flowers. {ECO:0000269|PubMed:18500650}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013593826.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593826.10.0PREDICTED: scarecrow-like protein 15
SwissprotO232100.0SCL15_ARATH; Scarecrow-like protein 15
TrEMBLA0A078FJA70.0A0A078FJA7_BRANA; BnaC07g03310D protein
TrEMBLA0A0D3D2Z50.0A0A0D3D2Z5_BRAOL; Uncharacterized protein
STRINGBo7g009980.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM42912857
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36710.10.0GRAS family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]