PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013593793.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CPP
Protein Properties Length: 488aa    MW: 54012.2 Da    PI: 6.7981
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013593793.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.72.7e-14128166241
             TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++k+CnCk s+Clk+YCeCfa+g++C+  C+C +C+N+ e
  XP_013593793.1 128 KQKHCNCKASRCLKLYCECFASGSYCNG-CNCVNCQNNLE 166
                     79**************************.********977 PP

2TCR51.71.7e-16212251140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeC++a++ Cse+C+C+dCkN e
  XP_013593793.1 212 KHSKGCHCKKSGCLKKYCECYQANVLCSENCRCQDCKNFE 251
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011145.4E-16127167IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.555128252IPR005172CRC domain
PfamPF036386.2E-11129164IPR005172CRC domain
SMARTSM011145.3E-19212253IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12215250IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MEKSDHDLSS HQNPLARQLD FSVPTAAVET KTIDSSRESE KKQSQSLLLD SESSREDQRD  60
EELPSQPSGT EEQHRLGVKS LEQPSATEDV TPPPQKPPLP RLGLPLGKCR VSKQEQMEAE  120
SKDGTPNKQK HCNCKASRCL KLYCECFASG SYCNGCNCVN CQNNLENESA RQEAITGTLE  180
RNPDAFKPKI AGSPHGINDL QEDVRQLLIL GKHSKGCHCK KSGCLKKYCE CYQANVLCSE  240
NCRCQDCKNF EGSEERSALL HGSHHVSETY IQQTTNAALS RAVSTSGFLN TPESRKRKSK  300
DASSAVPLLV QNQAVNRVMR NGDTSLFSIP NNKAVSGSPT CTYRSSLSNT IQPRHVKDLC  360
TLLVATSLDV ANKYSDKRRK HEKDPSLDPA QRDANEINDS PDCVLDSTRM DEKPLSPATR  420
ALMCDDEHVI TSEKETSAGV KTSQEKEEAD TSSEIYLDKE RQILSSFRDF LIELSNRGSI  480
KGTNIKSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-3312926111132Protein lin-54 homolog
5fd3_B4e-3312926111132Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1293298SRKRKS
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_013593793.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1728831e-105AC172883.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH125N23, complete sequence.
GenBankAC1893211e-105AC189321.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB036J07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013593793.10.0PREDICTED: protein tesmin/TSO1-like CXC 7
SwissprotF4JY840.0TCX7_ARATH; Protein tesmin/TSO1-like CXC 7
TrEMBLA0A0D3DCS30.0A0A0D3DCS3_BRAOL; Uncharacterized protein (Fragment)
STRINGBo7g095740.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM134631628
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25790.10.0Tesmin/TSO1-like CXC domain-containing protein